Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate WP_017549542.1 C792_RS0111190 TRAP transporter large permease
Query= uniprot:Q88NP0 (426 letters) >NCBI__GCF_000330705.1:WP_017549542.1 Length = 428 Score = 301 bits (772), Expect = 2e-86 Identities = 150/423 (35%), Positives = 263/423 (62%), Gaps = 3/423 (0%) Query: 4 FILLGSFIVLILIGMPVAYALGLSALIGAWWI-DIPLQAMMIQVASGVNKFSLLAIPFFV 62 ++L+ FI+L++IG+P+A+ +G+ AL+G I DIP + +++ +G++ F LLA+P F+ Sbjct: 3 YLLVLLFIILLVIGVPIAFVIGIVALLGMMTIPDIPGVIIPMKMVNGLDSFVLLAVPLFI 62 Query: 63 LAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLI 122 LA +M G +S +++ A +VG ++GGL+ N++ S F +SG+S ADTA G VLI Sbjct: 63 LAANLMNSGKISEKMIDLALAIVGPLKGGLAQANVLVSMIFAGVSGASQADTAGTGKVLI 122 Query: 123 PEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLL 182 P M + GY RE + VT + S ++ PPS ++++ A S+ +LF+ GI+PG+L+ Sbjct: 123 PSMLKNGYDRETAVGVTAASSTIGVVIPPSIPMIIFAGVANA--SVGTLFLGGIIPGILI 180 Query: 183 SAVMMGLCLIFAKKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGVFTATESA 242 MM + K+ YP + + L+E K +A L+ ++II+GGI++G+FTATESA Sbjct: 181 GLGMMIFIYFLSVKKGYPTFKKVHLKEMGKKLLDAFPALLTIIIIIGGIMTGLFTATESA 240 Query: 243 AVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPSKI 302 A+A V++ ++MF Y+ K RDLPK++ T+ ++ + + A++ G +++ Q+ + Sbjct: 241 AIASVYTLLISMFYYKTLKVRDLPKIIFDTLSLSALSLFALATASALGELLSYYQLATLA 300 Query: 303 TTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGMIM 362 T F ++V L+ I +++GT MD P +++ PI+LP G+DPVH G+I+ Sbjct: 301 QTFFTENISMKWVFLLLIIGFFLIIGTFMDAIPAMILFVPIILPASEAFGIDPVHLGLIV 360 Query: 363 LVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLWLP 422 ++ L +GL TPP G L + S IG +SIE + A++P+ L + VL+ + ++P + +P Sbjct: 361 IITLAVGLATPPYGLCLLIASKIGGLSIERSFTAVIPYLLIIVAVLLLIAFVPGLVFIIP 420 Query: 423 SVV 425 ++ Sbjct: 421 DMM 423 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 428 Length adjustment: 32 Effective length of query: 394 Effective length of database: 396 Effective search space: 156024 Effective search space used: 156024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory