Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_017549878.1 C792_RS0112920 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::A4VVI7 (210 letters) >NCBI__GCF_000330705.1:WP_017549878.1 Length = 211 Score = 156 bits (395), Expect = 2e-43 Identities = 77/184 (41%), Positives = 121/184 (65%), Gaps = 2/184 (1%) Query: 5 MLKQLKENYFFAVIRGKDEEDAKEIARHAILGGIRNIEITFSTPNAATVIKELQEEFSDD 64 +L+++K++ ++RG D EDA +IA + G IE+ ++PNA ++ ++EEF D Sbjct: 3 VLERIKDHRMIGILRGYDTEDALKIAGALVDTGFTVIEVALNSPNAKATVRAIKEEFGD- 61 Query: 65 SSVVIGAGTVMNLKLAQAAIDAGASFLVSPHFDKEIQDLAQEAEVFYFPGCATATEIVTA 124 +V+GAGTV+N + A I AGA FL+SP + KE+ D + + +V Y PGC T TEI A Sbjct: 62 -GIVLGAGTVLNTEDADDCISAGAEFLLSPVYSKEVLDFSCDRDVLYIPGCYTPTEIYNA 120 Query: 125 SQAGCPIIKLFPGGVLGPGFIKDIHGPVPDVNLMPSGGVSVENVADWKKAGACAVGVGSA 184 +AG +IK+FP G LG G+IKD+ P+ ++ L+P+GGV+ N+ ++ AGA A+G+ SA Sbjct: 121 HKAGAGMIKVFPAGGLGAGYIKDVLAPMNELVLLPTGGVTPGNINEFLDAGAAALGISSA 180 Query: 185 LASR 188 L + Sbjct: 181 LVPK 184 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 211 Length adjustment: 21 Effective length of query: 189 Effective length of database: 190 Effective search space: 35910 Effective search space used: 35910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory