Align glycerate 2-kinase (EC 2.7.1.165) (characterized)
to candidate WP_017549921.1 C792_RS0113140 glycerate kinase
Query= BRENDA::P23524 (381 letters) >NCBI__GCF_000330705.1:WP_017549921.1 Length = 398 Score = 292 bits (748), Expect = 1e-83 Identities = 158/380 (41%), Positives = 232/380 (61%), Gaps = 3/380 (0%) Query: 1 MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAE 60 M++V+ P +KESLS+ EV AIEKG R + P +P+ DGGEG VE ++ +G Sbjct: 1 MRVVVIPSGFKESLSSEEVGAAIEKGIRHVDPQHNVTVIPMVDGGEGFVETIVKLKEGRV 60 Query: 61 RHAWVTGPLGEKVNASWGISGDG--KTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELI 118 V GP+G+++++ +G+ + KTA IEMAA +GL VP +KR+PL TT+ G GE I Sbjct: 61 IPTDVVGPVGKRIDSFFGLFTENGVKTAVIEMAAIAGLRHVPGDKRNPLKTTTYGVGETI 120 Query: 119 LQALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGF-GGGSLNTLNDIDIS 177 ++AL+ GA I+IG G S T+DGG GM QA+G D +G+ I GGG ++ ++ +D+S Sbjct: 121 IKALDHGAERILIGCGDSGTSDGGVGMAQAVGVTFKDDDGSRISVEGGGEIDKIHSVDMS 180 Query: 178 GLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKAL 237 G+DPR+ I VA + N L G NG + +FGPQKGAS + +L NL H AEVI + Sbjct: 181 GIDPRIPATDIDVAVNWKNVLCGVNGVAHVFGPQKGASPEAVKKLSGNLDHLAEVIFRMT 240 Query: 238 HVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDS 297 D+ G GA+GG+GA L+ F GA L +I+ + + + I + LVIT EG ID Sbjct: 241 GEDLSKADGGGASGGLGAGLVGFTGAVLHPRFDIIRKYVEISDAIQNADLVITAEGCIDF 300 Query: 298 QSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRG 357 Q+ +GK+P VA +AK + KPVI AG++ V ++ GIDA S++ TL+++ Sbjct: 301 QTPNGKIPSEVARIAKSHDKPVIAFAGTIGRKAEVNYESGIDAFTSIIPKPATLEKSMTD 360 Query: 358 AYDNICRASRNIAATLAIGM 377 A + R + + LAIG+ Sbjct: 361 ASKWLQRCTESAFRHLAIGI 380 Lambda K H 0.315 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 398 Length adjustment: 30 Effective length of query: 351 Effective length of database: 368 Effective search space: 129168 Effective search space used: 129168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory