Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_017549708.1 C792_RS0112050 methionine ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000330705.1:WP_017549708.1 Length = 340 Score = 134 bits (337), Expect = 2e-36 Identities = 81/250 (32%), Positives = 138/250 (55%), Gaps = 21/250 (8%) Query: 3 LLEVKQLTKHFGG----LTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEG 58 ++E K L K F G + A+ D+ +++ +GE+ G++G +GAGK+TL + + +P+ G Sbjct: 1 MIEFKGLEKTFEGKHGTVHALKDINMKVGKGEIYGVVGFSGAGKSTLIRCVNYLEQPTAG 60 Query: 59 TVTLDGHLLNGKSPYKI--ASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFL 116 V +DG L S +I A +G FQ+ L TV N+ + Sbjct: 61 NVIVDGSDLTRISTKEIRNAKKKIGMVFQHFNLLNSKTVYANIAMP-------------- 106 Query: 117 RLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLD 176 L + +++ + +ELL L A+ LS GQ++R+ I RALAT P IL D Sbjct: 107 -LILDNAPKPKIRERVMELLDFVGLADKAKMYPDQLSGGQKQRIGIARALATRPSILLCD 165 Query: 177 EPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTP 236 E + ++PQ T + +L+++I +E+ ITI+LI H+M++V E+ R+ V+E+G +I +GT Sbjct: 166 EATSALDPQTTDSILKLLQKINEEYNITILLITHEMSVVREICNRVAVMEHGNVIEEGTV 225 Query: 237 DEIKTNKRVI 246 EI +N + + Sbjct: 226 FEIFSNPQTV 235 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 340 Length adjustment: 26 Effective length of query: 228 Effective length of database: 314 Effective search space: 71592 Effective search space used: 71592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory