Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_017548275.1 C792_RS0104590 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000330705.1:WP_017548275.1 Length = 307 Score = 115 bits (288), Expect = 1e-30 Identities = 75/234 (32%), Positives = 121/234 (51%), Gaps = 21/234 (8%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 N+ +LK G++K+F A+ V ++I++G +YG IG NGAGK+T ++TGL P G+ Sbjct: 2 NDYILKTNGLTKKFKNHHAVDKVDLSIRKGDIYGFIGQNGAGKSTMLRLVTGLSFPTEGS 61 Query: 66 FELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTK 125 E+ G T +++ K + ++ LF+EMT+ EN+ V R R K Sbjct: 62 LEIFGTDAR-TGLNDAQKR-MGAIIESPALFSEMTSRENLEVHR-------------RQK 106 Query: 126 GFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPA 185 G E E L VG+ + KA+ S G ++RL +A AL +DP+ + LDEP Sbjct: 107 GIPGREC-----IDETLRLVGLSGTGEKKAKNFSLGMKQRLGLAMALLSDPEFLILDEPT 161 Query: 186 AGMNATEKVQLRELIDRI-RNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAE 238 G++ V+ R+LI ++ R T+L+ H + + L ++ GK I E Sbjct: 162 NGLDPIGIVEFRDLIRKLNREKGLTVLISSHILGELYQLATTYGIIHEGKLIEE 215 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 307 Length adjustment: 26 Effective length of query: 234 Effective length of database: 281 Effective search space: 65754 Effective search space used: 65754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory