Align Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component (characterized)
to candidate WP_017549669.1 C792_RS0111855 PTS sugar transporter subunit IIA
Query= SwissProt::P17876 (144 letters) >NCBI__GCF_000330705.1:WP_017549669.1 Length = 141 Score = 161 bits (408), Expect = 3e-45 Identities = 76/141 (53%), Positives = 106/141 (75%) Query: 4 LFSNENIFLNQSFEDQNEAIEKAGQALVDAGAVTEDYIQAMKDREAVVSTFMGNGLAIPH 63 + ENI LNQ+ + + I +AGQ LVD G+V YI +M RE VVSTFMGNGLAIPH Sbjct: 1 MLKKENIVLNQTAGSKEDVIRQAGQLLVDQGSVEPAYIDSMLAREEVVSTFMGNGLAIPH 60 Query: 64 GTDEAKSAVLQSGLTLLQIPEGVQWGDDVAKVVVGIAGKDGEHLDLLSKIAITFSEEENV 123 GTDE K++V++SGL+L+Q+P GV + + AKV++GIAGK+ EHLD+L KIA+ FS+E+N Sbjct: 61 GTDEGKTSVIESGLSLIQVPGGVDFDGNEAKVILGIAGKENEHLDMLQKIAVLFSDEDNA 120 Query: 124 DRIVNTKSPEEIKAVFEEADV 144 +R++N S +EI ++FE D+ Sbjct: 121 ERVINASSADEIISLFENEDI 141 Lambda K H 0.311 0.130 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 144 Length of database: 141 Length adjustment: 16 Effective length of query: 128 Effective length of database: 125 Effective search space: 16000 Effective search space used: 16000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory