Align GutB, component of The Glucitol Enzyme II complex, IICBC (GutA1A2) IIA (GutB) (characterized)
to candidate WP_017549995.1 C792_RS0113510 PTS glucitol/sorbitol transporter subunit IIA
Query= TCDB::O32334 (122 letters) >NCBI__GCF_000330705.1:WP_017549995.1 Length = 119 Score = 75.5 bits (184), Expect = 2e-19 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 1/110 (0%) Query: 11 VKDLGDLAETFLEEGMIIFFGDNAPDTLADYCYSINIKEVKETIKPGQVFMIDGIAFEIT 70 + +LG+ E E M+I F +++P L D ++ V E ++ G V + +++I Sbjct: 8 ISELGNEWEMMKSENMVILFNEDSPQELRDISV-VHDGAVSEIVEAGDVMELGDESYDIL 66 Query: 71 AVGDVAEKNLVSLGHITVAFNGSKVPTLSGTICVEKKEIPKLKIGSELSI 120 VG A + L LGH T FNG L GTIC+EKKEIP L+IG ++ I Sbjct: 67 FVGGKANETLRELGHATFQFNGQSDSDLPGTICLEKKEIPSLEIGQKVII 116 Lambda K H 0.317 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 58 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 122 Length of database: 119 Length adjustment: 13 Effective length of query: 109 Effective length of database: 106 Effective search space: 11554 Effective search space used: 11554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory