Align PTS system glucitol/sorbitol-specific EIIB component; EII-Gut; Enzyme II-Gut; Glucitol/sorbitol-specific phosphotransferase enzyme IIB component; EC 2.7.1.198 (characterized)
to candidate WP_017549996.1 C792_RS0113515 PTS glucitol/sorbitol transporter subunit IIB
Query= SwissProt::O32333 (336 letters) >NCBI__GCF_000330705.1:WP_017549996.1 Length = 338 Score = 323 bits (829), Expect = 3e-93 Identities = 167/338 (49%), Positives = 224/338 (66%), Gaps = 7/338 (2%) Query: 4 YNAIKIVKGSGGFGGPLTVKPEEGKDTLLYITGGGAEPEIVEKIVNLTGCKAVNGFKTSV 63 Y ++KI KGSGG+GGPL V P K ++ +TGGG +P + + I + TG +AV+GF T V Sbjct: 2 YKSVKISKGSGGWGGPLMVTPSAEKPYVVSVTGGGIDP-LAQYIADQTGAEAVDGFNTKV 60 Query: 64 PEEQIFLVIIDCGGTLRCGIYPQKRIPTINVMPVGKSGPLAKFITEDIYVSAVGLNQISL 123 +++ VIIDCGGT RCGIYP+ + T+N+ G SGPL +FI ED +VS V I L Sbjct: 61 DYDEMACVIIDCGGTARCGIYPKNDVLTVNLHGTGPSGPLMQFIKEDNFVSGVRERNIEL 120 Query: 124 ADSSA------EPIKSTKVPEEGKREFKYSADKKVSQSLAENSKSSIVQKIGMGAGKVVN 177 ++ P+K + +E K A +KV+ + E K +++IG G +V+ Sbjct: 121 SEDGGTSSDGTNPVKPAAAGRKTSKELKEEAKQKVADNKKEPEKKKFIERIGRAMGGIVS 180 Query: 178 TLYQAGRDAVQSMITTILPFMAFVAMLIGIIQGSGFGNWFAKILVPLAGNGIGLMILGFI 237 YQAGR+ + +I ILPFMAFV+MLIGII +G G+ A + PLAGN +GL++L I Sbjct: 181 VFYQAGRETIDQVIKNILPFMAFVSMLIGIITFTGIGDLIANAVTPLAGNILGLLLLSVI 240 Query: 238 CSIPLLSALLGPGAVIAQIVGTLIGVEIGKGTIPPSLALPALFAINTQCACDFIPVGLGL 297 S+P+LS +LGPGAVIAQ+VG LIGVEIG G IPP +ALPALFAIN Q DF+PVGL L Sbjct: 241 VSLPVLSPVLGPGAVIAQVVGVLIGVEIGNGNIPPEMALPALFAINPQAGADFVPVGLTL 300 Query: 298 AEAEPETVEVGVPSVLYSRFMIGVPRVAVAWVASIGLY 335 EAEPET+EVGVP+VL+SR + G V +A+ S +Y Sbjct: 301 GEAEPETIEVGVPAVLFSRAITGPLAVLIAFGFSFFIY 338 Lambda K H 0.319 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 338 Length adjustment: 28 Effective length of query: 308 Effective length of database: 310 Effective search space: 95480 Effective search space used: 95480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory