Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate WP_017549888.1 C792_RS0112970 NAD-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_5145 (295 letters) >NCBI__GCF_000330705.1:WP_017549888.1 Length = 291 Score = 151 bits (381), Expect = 2e-41 Identities = 92/289 (31%), Positives = 150/289 (51%), Gaps = 8/289 (2%) Query: 1 MKIAFIGLGNMGAPMARNLIKAGHALRLVDLNKAVLAELEQLGGSISASAREAAEGAELV 60 MKI FIGLG MGAPM +NL+K H + + DLN + G + AS +E AE AE Sbjct: 1 MKIGFIGLGIMGAPMVKNLLKDNHTVYVNDLNAEAVEMAVSHGATAVASLQEMAENAEAF 60 Query: 61 ITMLPAAVHVRSVWL-GEDGVLAGIGKGVPAVDCSTIDPQTARDVAAAAAKQGVAMADAP 119 ITMLP V+SV L E+G+ + +G VD S++ P + ++ A + V ADAP Sbjct: 61 ITMLPNGAIVKSVLLDAENGLYPHLKEGQVVVDMSSLTPTDSIEIGAKLEAKKVIFADAP 120 Query: 120 VSGGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLGI 179 VSGG A G L+ M G E FA ++ ++A M ++++ G++G G K+ N +++ + Sbjct: 121 VSGGEPLAITGELSVMAGCREEHFARVEEIVASMSKSVIRVGDIGAGSTVKLSNQIIVNV 180 Query: 180 SMVGVSEAMALGDALGIDTKVLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFG 239 ++ +SEA+ + ID + + I + G S+ M +P ++ + Y G Sbjct: 181 NIAALSEAVVMAKKFDIDLEAMFEAIRN--GLAGSNVMEAKFPKMI-----AEDYNPGGT 233 Query: 240 AELMLKDLGLATEAARQAHQPVVLGAVAQQLYQAMSLRGEGGQDFSAII 288 + KDL T + + L + +++Y++ + G G D S +I Sbjct: 234 ININYKDLYNVTSTSDAEQLSLPLSNMVKEMYKSEVINGNGMNDHSGVI 282 Lambda K H 0.317 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 291 Length adjustment: 26 Effective length of query: 269 Effective length of database: 265 Effective search space: 71285 Effective search space used: 71285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory