Align lactose 3-dehydrogenase γ subunit (EC 1.1.99.13) (characterized)
to candidate WP_008626954.1 C943_RS09210 gluconate 2-dehydrogenase subunit 3 family protein
Query= metacyc::MONOMER-15714 (182 letters) >NCBI__GCF_000330725.2:WP_008626954.1 Length = 197 Score = 99.4 bits (246), Expect = 4e-26 Identities = 62/196 (31%), Positives = 90/196 (45%), Gaps = 17/196 (8%) Query: 2 LNRRDALRGLALTVGAAA-----TGWAGTAAATTALSWTPTALTPEQAQILDVVAELIIP 56 +NRRDA+R AL G AA + L+W P L+ +QA+ + + I+P Sbjct: 1 MNRRDAIRKTALMAGTAAGVPSFLSLLQACSKQERLTWVPEFLSEDQARFISAFVDTILP 60 Query: 57 ATDTPGARAAGVPQFIDRAIANYCEKWQVDQLVGGFARMDADAKAAHGKLFVALAPEQQV 116 TDTPGA FID A ++ + +V + +A AK G +F L+ E + Sbjct: 61 KTDTPGALDVKADVFIDLVYARTYDQKAQENVVAEIEKFNATAKDKFGNVFADLSLEDKT 120 Query: 117 AILNVYDRE----------TAVSTSG--HFFPLLEDFVTVGYFTSEPGATLALKYDPVPG 164 A L + TAV F+ L+ YF+SE L YDP+PG Sbjct: 121 AFLKEQEANSPKFNPRVWGTAVGKQEPVGFYRGLKSMTLWAYFSSEEIGKNVLSYDPIPG 180 Query: 165 AYNGCVPLAEIGRGWA 180 Y GC+PLA++G W+ Sbjct: 181 EYKGCIPLADVGNSWS 196 Lambda K H 0.320 0.134 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 182 Length of database: 197 Length adjustment: 20 Effective length of query: 162 Effective length of database: 177 Effective search space: 28674 Effective search space used: 28674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory