Align L-lactate dehydrogenase; EC 1.1.1.27 (uncharacterized)
to candidate WP_015333884.1 FAES_RS24460 Ldh family oxidoreductase
Query= curated2:Q07251 (349 letters) >NCBI__GCF_000331105.1:WP_015333884.1 Length = 355 Score = 142 bits (358), Expect = 1e-38 Identities = 110/345 (31%), Positives = 166/345 (48%), Gaps = 33/345 (9%) Query: 16 LAAQQVPADIADDVAEHLVESDRCGYISHGLSILPNYRTALDGHSVNPQGRAKCVLDQGT 75 + + A +A DV LV +D G SHG++ LP Y D +NP K V + + Sbjct: 18 IGCSEADARLAADV---LVSADLRGVDSHGVARLPGYVRLYDNGRLNPTPAIKIVHETPS 74 Query: 76 LMVFDGDGGFGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMGHYGEMAAAAGFVLL 135 V DGD G G VG MQ AI++ R G V +R S+H G G++ +A + Sbjct: 75 TAVVDGDRGLGLVVGPWAMQVAIDKARVAGTGWVAVRNSNHFGIAGYHALLATDHDMIGQ 134 Query: 136 SFTNVINRAPVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIATSAIAINKARVLAEK 195 + T+ AP+VAP L TNP+ A P PP + D A++A+A K +L K Sbjct: 135 AMTHA---APLVAPTFSLDKLLGTNPIAVAIPAAT-EPPFLADFASTAVAYGKLEILQRK 190 Query: 196 GEPAPEGSIIGADGNPTTDASTMFGEHPGALLPF------GGHKGYALGVVAELLAGVLS 249 G+PAP G ADG PTTD++ + ++ GALLP G HKGY LG + ++ +GVLS Sbjct: 191 GQPAPLGWAQDADGQPTTDSNAV--KNGGALLPLGSDREHGSHKGYGLGAIVDIFSGVLS 248 Query: 250 G---GGTIQPDNPRG--------GVATNNLFAVLLNPALDLGLDWQSAEVEAFVRYLHDT 298 G G + P G GV T + F + A ++++ ++ +++ Sbjct: 249 GANYGPWVPPFATAGFMSANEGVGVGTGHFFGAMRIDAFRPAAEFKN-HMDTWIQRFRSA 307 Query: 299 PPAPGVDRVQYPGEYE---AANRAQASDTLNINPAIWRNLERLAQ 340 G +V PG+ E A R QA + ++ + + LE L + Sbjct: 308 KAVAG-KQVLVPGDPERLMEAERLQAG--IPVHETVVQQLEHLGE 349 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 355 Length adjustment: 29 Effective length of query: 320 Effective length of database: 326 Effective search space: 104320 Effective search space used: 104320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory