Align Glycerol uptake facilitator protein 3 (characterized)
to candidate WP_015330711.1 FAES_RS08050 aquaporin family protein
Query= SwissProt::F9UTW9 (240 letters) >NCBI__GCF_000331105.1:WP_015330711.1 Length = 241 Score = 255 bits (651), Expect = 6e-73 Identities = 124/233 (53%), Positives = 164/233 (70%), Gaps = 6/233 (2%) Query: 11 LGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVY-ASSFMS-PAH 68 LGE +GT +L+LLGDGVVA V L ++K + GW+ IT GW FAVT+ ++ A +F S AH Sbjct: 7 LGELIGTMVLLLLGDGVVANVVLKQTKGNSGGWIVITTGWAFAVTIAIFVAKAFGSIDAH 66 Query: 69 LNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFA 128 LNPAV+L AVA +++VIP+ AQ+ GGV+GG++VWL Y PHW T D G L +F Sbjct: 67 LNPAVTLAFAVATN-DYSHVIPFFTAQMLGGVLGGILVWLLYLPHWAVTPDPGDKLAVFC 125 Query: 129 TGPGIRRYFWNFISEVIGTFVLVFGLLAFTK---GQFTAGLNPIVVGILIIAIGLSLGGT 185 P IR+ N +SE I T V + GL + G G+ P +VG+L+ +IGLSLGG Sbjct: 126 NSPAIRKTGPNLLSEAIATTVFILGLSGISSKALGVLATGVGPYLVGVLVWSIGLSLGGP 185 Query: 186 TGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNV 238 TGYAINPARDLGPR+AHA+LPI KG+SDWAY+W+P+AGPL+G A+G +L + Sbjct: 186 TGYAINPARDLGPRVAHALLPIPGKGSSDWAYAWIPVAGPLIGAAVGGVLIQL 238 Lambda K H 0.325 0.143 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 241 Length adjustment: 23 Effective length of query: 217 Effective length of database: 218 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory