Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_015331161.1 FAES_RS10375 ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_000331105.1:WP_015331161.1 Length = 626 Score = 84.0 bits (206), Expect = 7e-21 Identities = 70/213 (32%), Positives = 110/213 (51%), Gaps = 12/213 (5%) Query: 21 ALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRLEGKPIQFRSPMEARQ 80 AL F L GE LA++G+NGAGK++++K ++ P EG I L+G ++ + R+ Sbjct: 396 ALRGLSFTLQAGEKLALVGENGAGKTTLVKLLARLYDPTEGRILLDGHDLRDYDLDDLRR 455 Query: 81 AGIETVYQNLALSPALSIADNMFLG---REIRKPGIMGKWFRSLDRAAMEKQARAKLSEL 137 I ++Q+ + +S N+ +G +P I RSL + K A +L Sbjct: 456 -HIGVIFQDY-IRFKMSAGTNIAVGDIDERTNQPRIETSAQRSLADTVIAKLAGGYSQQL 513 Query: 138 GLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRVLELILDV 197 G ++ NQ VE LSGG+ Q VA+ RA ++++I+DEPTAAL + V + + Sbjct: 514 G----KSFNQGVE-LSGGEWQKVALGRAYMRDAQLIILDEPTAALDARAEYEVFQR-FNA 567 Query: 198 RRRGLPIVLISHNMPHVFEVADRIHIHRLGRRL 230 G V+ISH V +ADRI + G+ L Sbjct: 568 LTEGKSSVIISHRFSTV-RMADRILVLENGQLL 599 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 626 Length adjustment: 31 Effective length of query: 229 Effective length of database: 595 Effective search space: 136255 Effective search space used: 136255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory