Protein WP_007695653.1 in Halococcus hamelinensis 100A6
Annotation: NCBI__GCF_000336675.1:WP_007695653.1
Length: 332 amino acids
Source: GCF_000336675.1 in NCBI
Candidate for 34 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-proline catabolism | opuBA | med | BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) | 43% | 95% | 263.5 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-histidine catabolism | hutV | med | ABC transporter for L-Histidine, ATPase component (characterized) | 41% | 88% | 182.6 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-proline catabolism | hutV | med | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 41% | 82% | 175.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-glutamate catabolism | gltL | med | GluA aka CGL1950, component of Glutamate porter (characterized) | 40% | 98% | 165.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-asparagine catabolism | aatP | med | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 40% | 89% | 146.7 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-aspartate catabolism | aatP | med | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 40% | 89% | 146.7 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-proline catabolism | proV | lo | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 47% | 55% | 199.1 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 36% | 78% | 158.7 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-arginine catabolism | artP | lo | Arginine transport ATP-binding protein ArtM (characterized) | 38% | 98% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 36% | 92% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 36% | 92% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 36% | 92% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-histidine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 36% | 92% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 36% | 92% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 36% | 92% | 153.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 35% | 93% | 152.1 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-asparagine catabolism | bgtA | lo | ATPase (characterized, see rationale) | 34% | 91% | 151.8 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-aspartate catabolism | bgtA | lo | ATPase (characterized, see rationale) | 34% | 91% | 151.8 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-lysine catabolism | hisP | lo | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 34% | 91% | 147.5 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 37% | 83% | 144.4 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 37% | 83% | 144.4 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-glucosamine, ATPase component (characterized) | 36% | 94% | 143.3 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-histidine catabolism | hisP | lo | Histidine transport ATP-binding protein HisP (characterized) | 35% | 94% | 138.7 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 33% | 89% | 137.9 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-citrulline catabolism | AO353_03040 | lo | ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) | 31% | 97% | 131.7 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-alanine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 100% | 118.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-isoleucine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 100% | 118.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-leucine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 100% | 118.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-serine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 100% | 118.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-threonine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 100% | 118.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-valine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 31% | 100% | 118.2 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-proline catabolism | HSERO_RS00900 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 89% | 112.1 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-serine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 89% | 112.1 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
| L-tyrosine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 89% | 112.1 | Carnitine transport ATP-binding protein OpuCA; EC 7.6.2.9 | 45% | 284.3 |
Sequence Analysis Tools
View WP_007695653.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MIRFDNVHKQYPDGTRAVDGHDFEVEEGTTTVLVGPSGCGKTTTMRLVNRLEEPTEGTIY
YDGTDIEELEATDLRREIGYVIQDIGLFDHMTVGENVATVPELKGWEAERTADRVDELLE
LMGLPPEEFRDSYPGELSGGQQQRVGVARALAAGPDVMLMDEPFGALDPITREELQDEFL
DIQKEIDTTIVFVTHDINEALKMGDKIAVMNEGKVVQYDTPTALLDNPKTKFVEEFIGPD
RTLKRLRVLRVEEVMQAEIPDEHAAVVDAFQADDAVMADGGEIIPVSPGDTAQVALSRCI
QAGVEALPVVEDADVVGIVTEAAIRDRQTGPA
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory