Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate WP_007692562.1 C447_RS07650 carbohydrate ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >NCBI__GCF_000336675.1:WP_007692562.1 Length = 290 Score = 145 bits (366), Expect = 1e-39 Identities = 87/261 (33%), Positives = 137/261 (52%), Gaps = 2/261 (0%) Query: 45 ILVLWAFMVVLPLLWAVMTSFKDDASIFGSPWSL-PDKLHFDNWSRAWTEAHMGDYFLNT 103 IL++ + +V PLLW V T+ K + + P +L P+ + A T +FLNT Sbjct: 28 ILLVTSALVAFPLLWMVSTALKTGSDLTAFPPTLVPENPSLEPTIEALTTGPWAQWFLNT 87 Query: 104 VLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNNMG 163 LVV G++I LV+ AAY LAR +F G+R +Y + + P + ++P+F + Sbjct: 88 FLVVIGAVILELVVAVPAAYALARREFLGDRLVYVSIVAFLMIPPQILVLPIFIQFAQLQ 147 Query: 164 LLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKP 223 LL T GLI+ Y F F L+ FF+TLPS V +AA + G + F +I+LP+AKP Sbjct: 148 LLETFVGLIVAYTLLFSAFVTFLLSGFFQTLPSDVEDAARIAGIPEWKIFVRIVLPLAKP 207 Query: 224 GLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAM 283 + IF F+ WN++ V + + ++ GL +QG + L A V+ Sbjct: 208 AIGIAAIFVFIFAWNEFFWALVFLNEQEMYTISIGLTIFEGTQGQIA-MNRLMAMSVLTT 266 Query: 284 LPVLAAYIIFQRQVVQGLTAG 304 +PVL + + Q + +QG+T G Sbjct: 267 IPVLVLFALTQERFIQGITTG 287 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 290 Length adjustment: 27 Effective length of query: 280 Effective length of database: 263 Effective search space: 73640 Effective search space used: 73640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory