Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_007692481.1 C447_RS07405 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_000336675.1:WP_007692481.1 Length = 383 Score = 188 bits (477), Expect = 2e-52 Identities = 109/300 (36%), Positives = 172/300 (57%), Gaps = 17/300 (5%) Query: 19 LSLHMGVIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLALFVGAALAVAGVLIQGIVRN 78 L L + +P RAL ++ RLPR+L+A FVG LA++G + Q + RN Sbjct: 88 LGLSTAAVDLPQRAL------------IVWNIRLPRVLVAAFVGTNLAISGAIFQAVTRN 135 Query: 79 PLASPDILGVNHAASLASVGALLLMPSLPVMVLPLLAFAGGMAGLILLKMLAKTH--QPM 136 LASP ILGV+ A LA + L++ L + LP+ A GG +++ +A + P+ Sbjct: 136 ELASPFILGVSSGAGLAILLTLVVFSGLTAL-LPVTASLGGAVAFLIVYAIAWQNGTSPV 194 Query: 137 KLALTGVALSACWASLTDYLMLSRPQ--DVNNALLWLTGSLWGRDWSFVKIAIPLMILFL 194 +L L GV +S + SL L V A+ W TGSL G DW V+IA+P IL Sbjct: 195 RLVLAGVIVSTVFQSLQTGLFFFADDLGIVQQAISWTTGSLTGTDWEQVRIALPWTILAT 254 Query: 195 PLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVP 254 L+L+ R L++L LG+ A +LG+SV RF +A+ + ++ G +SF+GL+VP Sbjct: 255 VLALAGARQLNVLLLGERTAKSLGMSVERVRFALSGIAILAAAASISVAGIVSFVGLIVP 314 Query: 255 HMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLL 314 H++R++ G ++RL+ G L+V AD+ AR+ P+++PVG++T +IG P+F++L+ Sbjct: 315 HVVRNLVGSDYKRLMVGCVFAGPALMVAADVGARLALNPVQIPVGIVTGLIGGPYFLYLM 374 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 383 Length adjustment: 29 Effective length of query: 289 Effective length of database: 354 Effective search space: 102306 Effective search space used: 102306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory