Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_007691835.1 C447_RS05920 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_000336675.1:WP_007691835.1 Length = 247 Score = 240 bits (612), Expect = 2e-68 Identities = 128/247 (51%), Positives = 167/247 (67%), Gaps = 11/247 (4%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 LE ++K +G VL+ V L +V +IG SGSGKST LRC N LE +G+I L Sbjct: 9 LEFDGVNKYFGDAHVLRDVDLDVEDREVCVVIGPSGSGKSTLLRCANRLEAIQSGEIRLE 68 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 E + +A + R+R R+ MVFQ FNL+ H TA+EN+ P V G+SK Sbjct: 69 GEAI-----------SAPDADINRLRQRIGMVFQSFNLFPHKTALENVTLGPRKVKGISK 117 Query: 124 AEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 +ARE+AE LA VG+S + D+YPG +SGG+QQRVAIARALAMEP+VMLFDE TSALDPE Sbjct: 118 NDARERAEELLASVGLSDQTDSYPGQLSGGQQQRVAIARALAMEPDVMLFDEVTSALDPE 177 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 LVG+VL VM LA+EG TM+VVTH+MGFAREV +++V + +G + E+ P +P ++ Sbjct: 178 LVGEVLDVMGELAEEGMTMLVVTHQMGFAREVGDRVVLMSEGRIVETAEPERFFADPDTD 237 Query: 244 RLQQFLS 250 R QQFLS Sbjct: 238 RAQQFLS 244 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 247 Length adjustment: 24 Effective length of query: 230 Effective length of database: 223 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory