Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate WP_007696034.1 C447_RS16755 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21219 (281 letters) >NCBI__GCF_000336675.1:WP_007696034.1 Length = 279 Score = 148 bits (373), Expect = 1e-40 Identities = 93/270 (34%), Positives = 148/270 (54%), Gaps = 12/270 (4%) Query: 13 HASALLLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSAGAA 72 HA +L VV L P+AW+ MS+ P + P W I L + V++ AA Sbjct: 16 HAVLVLWTVVALFPLAWITFMSLKPPGEAITLPPDW----IFLPTVYNYIQLVQD---AA 68 Query: 73 FIASLLNSIKVAGMATLAAVVVAVPAAWAVSR--TPAVAWSLYAVIATYMLPPVALAVPL 130 F+ + NS+ + + ++V VP A+ +SR P L ++++ MLPPVA+ +P Sbjct: 69 FVHAYANSLISVSASVVLVLLVGVPGAYVLSRYDVPKKPDVLIWILSSRMLPPVAVVIPF 128 Query: 131 YMGLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQILRI 190 ++ F L +++ GL +Y+TI W++KS FD IP +E AAM+DGA Q R Sbjct: 129 FVIFRTFDLYDTLIGLVFMYITINISVVVWVMKSFFDGIPESLEEAAMVDGATRSQAFRK 188 Query: 191 LTLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSDYGLIAT 250 + LP A P + + A+ +F+ AW E ++L+ T++Q A T+++ + G R +Y ++A Sbjct: 189 VVLPSAVPGIISVAVISFIFAWIELLFSLVLTNNQ-AVTVSLQVYTFIGSRNIEYSMLAA 247 Query: 251 AGVLAALPPVLIGLI-MQRALISGLTSGGV 279 A +A + PVLI LI R L SGL+ G V Sbjct: 248 AS-MAMIVPVLIFLIAANRYLASGLSFGVV 276 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 279 Length adjustment: 26 Effective length of query: 255 Effective length of database: 253 Effective search space: 64515 Effective search space used: 64515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory