Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_007691407.1 C447_RS04675 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000336675.1:WP_007691407.1 Length = 528 Score = 165 bits (418), Expect = 2e-45 Identities = 97/277 (35%), Positives = 148/277 (53%), Gaps = 8/277 (2%) Query: 42 ADGG---IGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTES 98 AD G + S ++ + E A L + +G D D+ T G+++AN P+ + Sbjct: 40 ADAGALVVRSGTEVGREVFEAAPELTIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRA 99 Query: 99 TADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVAR 158 A+ ++ A+AR + + +K G W S G ++ G TLGIVG GR+G VA+ Sbjct: 100 AAEHTVAMTFAAARSIPQAHGRLKQGEWAKS---DYLGTELNGATLGIVGFGRVGQEVAK 156 Query: 159 RAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAE 218 + G M ++ + + + GA VEL E LA AD + L PLTPET+ LI + E Sbjct: 157 KLD-GLGMNLVAYDPYISEERAGRLGAELVELDECLAQADVLTLHTPLTPETEDLISSDE 215 Query: 219 LKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVA 278 L M L+N +RG VDE AL A++ GT+ GA +DVF EPL DSPLL + +VV Sbjct: 216 LDRMD-GGFLVNCARGGVVDEDALAAAVEAGTLRGAAIDVFADEPLSPDSPLLDVDDVVV 274 Query: 279 LPHIGSATHETRHAMARNAAENLVAALDGTLTSNIVN 315 PH+G++TH + +A + A+ +++A N +N Sbjct: 275 TPHLGASTHAAQENVATDIADQVLSAFRNEPVMNALN 311 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 528 Length adjustment: 31 Effective length of query: 290 Effective length of database: 497 Effective search space: 144130 Effective search space used: 144130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory