Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_007691018.1 C447_RS03550 ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_000336675.1:WP_007691018.1 Length = 367 Score = 136 bits (342), Expect = 7e-37 Identities = 87/248 (35%), Positives = 132/248 (53%), Gaps = 14/248 (5%) Query: 2 TSPTAPLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPIS 61 T+PT + D + FG + LR V+ + + +++GPSGCGK+T LR + E + Sbjct: 12 TNPTG--VELDDVTVRFGDVAALRDVSLAVEDGEFFTLVGPSGCGKTTTLRAIAGFETPA 69 Query: 62 GGRLEVAGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMA 121 G + + G ++ G + ++ VG+VFQ++ LFPHL+V +N+ R P Sbjct: 70 TGAVRIGGREMGGVPPEDRN-------VGVVFQNYALFPHLSVRENVGYGLR--FHDPPG 120 Query: 122 EA--KDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDP 179 E ++R L V + A+ PD LSGGQ+QRVA+AR L P++LL DEP SALD Sbjct: 121 EVTTRERVDDLLSLVDMADMAERDPDALSGGQQQRVALARALAPGPDVLLLDEPLSALDA 180 Query: 180 ELVGEVLNVMKQLAEE-GMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPK 238 L + +K + + +T VTH+ A VS+RV N G IE+ P V+R P Sbjct: 181 RLRERLRVTLKAIQRDLEITTIYVTHDQAEALAVSDRVAVVNDGRIEQVDTPERVYREPA 240 Query: 239 SDRLRAFL 246 S + F+ Sbjct: 241 SRFVAEFV 248 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 367 Length adjustment: 27 Effective length of query: 225 Effective length of database: 340 Effective search space: 76500 Effective search space used: 76500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory