Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_007693871.1 C447_RS10995 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000336675.1:WP_007693871.1 Length = 288 Score = 163 bits (413), Expect = 3e-45 Identities = 89/242 (36%), Positives = 148/242 (61%), Gaps = 16/242 (6%) Query: 40 AETGCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQL 99 +E V ++D+ ++ TGE ++G SG GK+TL+R L PT+GA++VDGE + Sbjct: 50 SERQSVQALDDVRFTVETGEFVCLVGPSGCGKTTLLRAVAGLETPTNGAVVVDGERVEGP 109 Query: 100 DMDALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLK 159 D MVFQ +GL P +V +NV +GL+ +G +++ C R ++ VGL Sbjct: 110 GTDR---------GMVFQEYGLFPWLTVQENVCFGLERQGMAREACDNRCYEMLDLVGLD 160 Query: 160 GYENKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLH 219 G+ + YP +LSGGM+QRV +ARALA D +I+L+DE F ++D R +Q++LL++ +T Sbjct: 161 GFADAYPKELSGGMKQRVAVARALAVDPEILLLDEPFGSVDARTRERLQNELLDIWRTTE 220 Query: 220 KTIVFITHDLDEAVRIGNRIAIL--KDGKLIQ---VGTPREILHSPADEYVDRFVQRRAA 274 KT +F+TH++DEAV +G+R+ ++ G++++ V PR S DE + +R + Sbjct: 221 KTTLFVTHEVDEAVVLGDRVLVMGADPGRVVETVDVDLPRP--RSRTDEAFVAYTERVRS 278 Query: 275 VV 276 ++ Sbjct: 279 LI 280 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 288 Length adjustment: 26 Effective length of query: 250 Effective length of database: 262 Effective search space: 65500 Effective search space used: 65500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory