Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_007692834.1 C447_RS08305 heme ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000336675.1:WP_007692834.1 Length = 270 Score = 109 bits (273), Expect = 5e-29 Identities = 74/229 (32%), Positives = 124/229 (54%), Gaps = 8/229 (3%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 ++ V+D+ Y DV L G++ ++ PGE+V ++GPNGAGK+TL + GL+TP+ G + Sbjct: 1 MIEVRDLGVSY-GDVDALSGVDLAVEPGEVVGLVGPNGAGKTTLLGAVNGLVTPTTGTVA 59 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQ--TLKDRIYT 121 G++++ L + + RR + VPQ ++ + V E + MG ++ + T +DR +T Sbjct: 60 VGGDDVSRLSARALARR-VATVPQQTDLSFAFPVREVVAMGRTPYRSRFERVTDEDREHT 118 Query: 122 M----FPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFA 177 +A+ ++R +SGGERQ + RAL DPD LLLDEP+A+L + + Sbjct: 119 RRAMERTDVARFADRRIDEVSGGERQRVVFARALCQDPDGLLLDEPTASLDINHQVRLLS 178 Query: 178 QIKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLND 226 ++A A G+A + + A DR +L G GS +L + Sbjct: 179 LLRAFVAEGRAALCAIHDLSLAARFCDRLVLLAGGTVLASGSPGEVLTE 227 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 270 Length adjustment: 24 Effective length of query: 216 Effective length of database: 246 Effective search space: 53136 Effective search space used: 53136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory