Align LacG, component of Lactose porter (characterized)
to candidate WP_007693922.1 C447_RS11150 carbohydrate ABC transporter permease
Query= TCDB::P29824 (273 letters) >NCBI__GCF_000336675.1:WP_007693922.1 Length = 282 Score = 171 bits (432), Expect = 2e-47 Identities = 93/267 (34%), Positives = 157/267 (58%), Gaps = 9/267 (3%) Query: 15 YSVLSLAAFLSIFPFIWMVIGTTNTTSQIIRG-----KVTFGTALFDNIASFFAQVDVPL 69 Y + A I P W+++ +T ++I+ ++ GT DN + + + Sbjct: 16 YGFVIAATMFVIVPIYWLLVASTLPQTEILGSAGSLPRLLPGTNFLDNAQALAGRQNANY 75 Query: 70 V--FWNSVKIALVGTALTLLVSSLAGYGFEMFRSKLRERVYTVILLTLMVPFAALMIPLF 127 NSV +A V T L+L++ S++G+ F + + +E ++ IL TL++P L+IPLF Sbjct: 76 YQSVINSVLVATVYTVLSLILCSMSGFAFAKYEFRFKEPIFLGILGTLIIPINLLVIPLF 135 Query: 128 MLMGQAGLLNTHIAIMLPMIASAFIIFYFRQASKAFPTELRDAAKVDGLKEWQIFFYIYV 187 +L+ GL NT AI+LP A IF+ RQ ++ P L +AA++DG E+Q+++ + + Sbjct: 136 LLVSNVGLSNTFAAIILPWAAYPVGIFFMRQTMQSIPDSLLEAARMDGASEFQLYYRVAL 195 Query: 188 PVMRSTYAAAFVIVFMLNWNNYLWPLIVLQSNDTKTITLVVSSLASAYSPEYGTVMIGTI 247 P +RS AA VI+F+ WN +LWPL+VLQ D TI + ++++ S +P + +M+ + Sbjct: 196 PTVRSGMAALSVILFLFQWNLFLWPLVVLQ-QDKFTIPVALTTIVSQQTPAFDQLMVAAL 254 Query: 248 LATLPTLLVFFAMQRQFVQGML-GSVK 273 +A +P L+VF A+QR FV G+L G+VK Sbjct: 255 IAIVPMLIVFVALQRHFVNGILAGAVK 281 Lambda K H 0.331 0.140 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 282 Length adjustment: 25 Effective length of query: 248 Effective length of database: 257 Effective search space: 63736 Effective search space used: 63736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory