Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_007693272.1 C447_RS09455 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000336675.1:WP_007693272.1 Length = 269 Score = 239 bits (611), Expect = 3e-68 Identities = 124/233 (53%), Positives = 169/233 (72%), Gaps = 1/233 (0%) Query: 3 DLLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEI 62 DLL V + AGY D+ IL ++ ++ GE VT++GPNGAGKST+ KT+FGL T GEI Sbjct: 37 DLLAVSALDAGY-GDLQILSAVDLAVHDGEYVTIVGPNGAGKSTVMKTVFGLTTYMGGEI 95 Query: 63 IFKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTM 122 F ++I+GL ++I+ RG+ YVPQ NVF L+V ENL+MGA++ Q D ++ Sbjct: 96 RFDDDDISGLAPERIIHRGVSYVPQNENVFAGLSVRENLEMGAYILDSVPQYRLDWVFER 155 Query: 123 FPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAI 182 FP L +R+ QRAGTLSGG+RQMLAMGRALMLDPDLL+LDEPSA L+P LV ++F +I AI Sbjct: 156 FPILEERQTQRAGTLSGGQRQMLAMGRALMLDPDLLMLDEPSAGLAPDLVDEMFDRIDAI 215 Query: 183 NATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 N +G AI++VEQNA +AL DRGYVL G+++ + +G++LL + V + +LG Sbjct: 216 NESGTAILMVEQNAVEALSRCDRGYVLVQGQNRFDDTGEALLGNDEVRQEFLG 268 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 269 Length adjustment: 24 Effective length of query: 216 Effective length of database: 245 Effective search space: 52920 Effective search space used: 52920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory