Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_007693030.1 C447_RS08815 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_000336675.1:WP_007693030.1 Length = 437 Score = 141 bits (355), Expect = 3e-38 Identities = 82/245 (33%), Positives = 133/245 (54%), Gaps = 14/245 (5%) Query: 11 LHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTIN 70 L + G + G+ + G+ + ++G SG GKST + E+P+EG I +G Sbjct: 23 LRREVGRVRAVDGIDFDLDRGETLGLVGESGCGKSTAATTLLRFEEPTEGEIEFDGT--- 79 Query: 71 LVRDKDGQLKVADKNQLRLLRTRLTMVFQHFN--LWSHMTVLENVMEAPIQVLGLSKQEA 128 L DK++L+ R R MVFQ N MT+ E+V E P++V GL ++ Sbjct: 80 -------DLLACDKDELKRFRRRAQMVFQDPNSSFDPRMTIGESVAE-PLRVHGLPRERR 131 Query: 129 RERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELV 188 R L +VG+D A +YP SGGQ+QR+++ARAL + P++++ DEP SALD L Sbjct: 132 RAVVRNTLERVGLDATAADRYPHEFSGGQKQRIALARALVLNPDLIVADEPVSALDVSLQ 191 Query: 189 GEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPR 247 E+L ++ + +E G ++ ++H+M + V V ++ G+I E G+ + +F +PQ P Sbjct: 192 AEILTLIDDIQQEFGLGILFISHDMSVIQQVCNRVAVMYLGEIVEIGSTDAVFSDPQHPY 251 Query: 248 LQRFL 252 Q L Sbjct: 252 TQALL 256 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 437 Length adjustment: 28 Effective length of query: 229 Effective length of database: 409 Effective search space: 93661 Effective search space used: 93661 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory