Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_007692556.1 C447_RS07635 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000336675.1:WP_007692556.1 Length = 362 Score = 290 bits (742), Expect = 4e-83 Identities = 160/357 (44%), Positives = 221/357 (61%), Gaps = 17/357 (4%) Query: 6 LKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGE 65 L +I K +G++ + + L I+ GEF++ VGPSGCGK+T LRMIAGLE+ + G ++ DG+ Sbjct: 5 LSNISKRFGSIVAVDDVSLTIENGEFLILVGPSGCGKTTTLRMIAGLEKPSSGRIYFDGD 64 Query: 66 RVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTP 125 V P +R IA VFQ+YALYPHMT NM+F + +E+ +RV AD L +T Sbjct: 65 DVTQFSPQQRHIAFVFQNYALYPHMTTRKNMSFALEDQDIPSDEVAQRVTSTADKLGITD 124 Query: 126 YLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSD 185 LD+ P LSGGQ+QRVA+GR+I RNP VFL DEPLSNLDA LR R E+ +L + + + Sbjct: 125 QLDQRPGELSGGQQQRVALGRSIVRNPSVFLLDEPLSNLDAKLRTNMRAELQELHQDL-E 183 Query: 186 TTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMNVIPA 245 TTM+YVTHDQ EAMT+ DRI V+ G I+QV P E Y +PAN FVA FIGSP+MN A Sbjct: 184 TTMVYVTHDQEEAMTMGDRIAVMDEGTIQQVAPPNEAYNQPANRFVAGFIGSPSMNFFDA 243 Query: 246 TITATGQQTAVSLAGG--KSVTLDVPTNASENGKTASFGVRPEDLRVT-EADDFLFEGTV 302 SL G ++ +PT +G + G+RPED+ VT A TV Sbjct: 244 -----------SLDDGRVRAGPFTLPTPDRVSGPLSELGIRPEDVSVTPTATGEDVSATV 292 Query: 303 SIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDTNGQS 359 ++ E +G ++Y+E ++ E +IA+ ++ GD V + D ++HLFD G + Sbjct: 293 TVFEQVGSSNIIYLE--IDGETMIAETDASVQLAPGDDVGVSLDTERVHLFDRGGDA 347 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 362 Length adjustment: 29 Effective length of query: 333 Effective length of database: 333 Effective search space: 110889 Effective search space used: 110889 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory