Align Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate WP_007693636.1 C447_RS10370 ABC transporter ATP-binding protein
Query= TCDB::Q72L52 (376 letters) >NCBI__GCF_000336675.1:WP_007693636.1 Length = 395 Score = 342 bits (878), Expect = 8e-99 Identities = 186/384 (48%), Positives = 245/384 (63%), Gaps = 26/384 (6%) Query: 1 MAKVRLEHVWKRFGKVVAVKDFNLETEDGEFVVFVGPSGCGKTTTLRMIAGLEEISEGNI 60 MA+V L +V KR+ +VAV D NLE DGEFV VGPSGCGK+TT+ +AGL +EG I Sbjct: 1 MAQVTLNNVTKRYDDIVAVDDMNLEIPDGEFVTLVGPSGCGKSTTMETVAGLTIPTEGEI 60 Query: 61 YIGDRLVNDVPPKDRDIAMVFQNYALYPHMNVYENMAFGLRLRRYPKDEIDRRVKEAARI 120 YIGDR V ++PPKDR IAMVFQN AL+PHM+VY+N++FGLRLR + KDE DRRV AA Sbjct: 61 YIGDREVTNLPPKDRGIAMVFQNIALFPHMDVYDNISFGLRLRNFDKDETDRRVDRAAET 120 Query: 121 LKIEHLLNRKPRELSGGQRQRVAMGRAIVREPKVFLMDEPLSNLDAKLRVEMRAEIAKLQ 180 +++E +L+R P E+SGGQRQRVA+ RA+VREP VFLMDEPL+NLDAKLRV MR E+ ++ Sbjct: 121 VQMEGMLDRMPSEMSGGQRQRVAIARALVREPDVFLMDEPLANLDAKLRVHMRTELQRIH 180 Query: 181 RRLGVTTIYVTHDQVEAMTLGHRIVVMKDGEIQQVDTPLNLYDFPANRFVAGFIGSPSMN 240 R LG T IYVTHDQ EAMT+ RI V+ DG++QQ+ PL Y+ PAN+FVAGFIGSPSMN Sbjct: 181 RELGTTIIYVTHDQAEAMTMSDRIAVINDGKLQQIAPPLTCYNEPANQFVAGFIGSPSMN 240 Query: 241 FVRAGVEVQGEKVYLVAPGFRIRANAVLGSALKPYAGKEVWLGVRPEHL---GLKGYTTI 297 F+R V G + V F A+ + V +G+RPE + G Sbjct: 241 FLRGTVGGNGFESEFVDVQFD-------PGAMNVSQDEPVTMGIRPEDVYPTDTAGSVAN 293 Query: 298 PEEENVLRGEVEVVEPLGAETEIHV--------------AVNGTLLVAKVDGHAPVKPGD 343 P E + +V+EP+G E +++ G L+ VD + + Sbjct: 294 PTTE--VEVTTDVLEPMGDEIFVYLLLADEAADTDLEDPGAGGNQLLMSVDPASDISEDQ 351 Query: 344 KVELLADTQRLHAFDLETDRTIGH 367 + ++ D +++H FD ET + H Sbjct: 352 TMRVVLDREKVHLFDAETGDALEH 375 Lambda K H 0.320 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 395 Length adjustment: 30 Effective length of query: 346 Effective length of database: 365 Effective search space: 126290 Effective search space used: 126290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory