Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_007692556.1 C447_RS07635 ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_000336675.1:WP_007692556.1 Length = 362 Score = 284 bits (727), Expect = 2e-81 Identities = 156/360 (43%), Positives = 214/360 (59%), Gaps = 15/360 (4%) Query: 3 SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI 62 +V+L N++K +G +V D++L I GEF++ VGPSGCGK+T LRMIAGLE +SG ++ Sbjct: 2 TVELSNISKRFGSIVAVDDVSLTIENGEFLILVGPSGCGKTTTLRMIAGLEKPSSGRIYF 61 Query: 63 GEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ 122 + P +R + VFQ+YALYPH++ +NMSF L+ + + QRV A+ L Sbjct: 62 DGDDVTQFSPQQRHIAFVFQNYALYPHMTTRKNMSFALEDQDIPSDEVAQRVTSTADKLG 121 Query: 123 LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKR 182 + LD++P LSGGQ+QRVA+GR++V PSVFLLDEPLSNLDA LR MR E+ LH+ Sbjct: 122 ITDQLDQRPGELSGGQQQRVALGRSIVRNPSVFLLDEPLSNLDAKLRTNMRAELQELHQD 181 Query: 183 LGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFL 242 L TM+YVTHDQ EAMT+ D+I V+D G + QV P E Y+ PA+RFVAGFIGSP MNF Sbjct: 182 LETTMVYVTHDQEEAMTMGDRIAVMDEGTIQQVAPPNEAYNQPANRFVAGFIGSPSMNFF 241 Query: 243 PVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIA-DVILE 301 + + LP P+R G LGIRPE + + A + Sbjct: 242 DASLDDGRVRAGPFTLPTPDRVS------------GPLSELGIRPEDVSVTPTATGEDVS 289 Query: 302 GEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTA 361 V V EQ+G+ I+++I + ++ + V + G + L ER HLF G A Sbjct: 290 ATVTVFEQVGSSNIIYLEIDG--ETMIAETDASVQLAPGDDVGVSLDTERVHLFDRGGDA 347 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 362 Length adjustment: 30 Effective length of query: 341 Effective length of database: 332 Effective search space: 113212 Effective search space used: 113212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory