Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_007693636.1 C447_RS10370 ABC transporter ATP-binding protein
Query= SwissProt::P19566 (369 letters) >NCBI__GCF_000336675.1:WP_007693636.1 Length = 395 Score = 305 bits (780), Expect = 2e-87 Identities = 168/378 (44%), Positives = 236/378 (62%), Gaps = 25/378 (6%) Query: 1 MASVQLRNVTKAWGDVVVSKDINLDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 60 MA V L NVTK + D+V D+NL+I DGEFV VGPSGCGKST + +AGL T G++ Sbjct: 1 MAQVTLNNVTKRYDDIVAVDDMNLEIPDGEFVTLVGPSGCGKSTTMETVAGLTIPTEGEI 60 Query: 61 FIGETRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVMNQRVNQVAEV 120 +IG+ + ++PP +RG+ MVFQ+ AL+PH+ V +N+SFGL+L K+ ++RV++ AE Sbjct: 61 YIGDREVTNLPPKDRGIAMVFQNIALFPHMDVYDNISFGLRLRNFDKDETDRRVDRAAET 120 Query: 121 LQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISRLH 180 +Q+ +L+R P +SGGQRQRVAI R LV EP VFL+DEPL+NLDA LRV MR E+ R+H Sbjct: 121 VQMEGMLDRMPSEMSGGQRQRVAIARALVREPDVFLMDEPLANLDAKLRVHMRTELQRIH 180 Query: 181 KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN 240 + LG T+IYVTHDQ EAMT++D+I V++ G++ Q+ PL Y+ PA++FVAGFIGSP MN Sbjct: 181 RELGTTIIYVTHDQAEAMTMSDRIAVINDGKLQQIAPPLTCYNEPANQFVAGFIGSPSMN 240 Query: 241 FLPVKVTATAIEQVQVELPNRQQIWLPVESRGVQVGANMSLGIRPEHLLPSD----IADV 296 FL V E V+ + + V +++GIRPE + P+D +A+ Sbjct: 241 FLRGTVGGNGFESEFVD------VQFDPGAMNVSQDEPVTMGIRPEDVYPTDTAGSVANP 294 Query: 297 TLEGEV--QVVEQLGHETQIHIQI-----------PAIRQNLVYRQNDVVL-VEEGATFA 342 T E EV V+E +G E +++ + P N + D + E T Sbjct: 295 TTEVEVTTDVLEPMGDEIFVYLLLADEAADTDLEDPGAGGNQLLMSVDPASDISEDQTMR 354 Query: 343 IGLPPERCHLF-REDGSA 359 + L E+ HLF E G A Sbjct: 355 VVLDREKVHLFDAETGDA 372 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 395 Length adjustment: 30 Effective length of query: 339 Effective length of database: 365 Effective search space: 123735 Effective search space used: 123735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory