Align 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) (characterized)
to candidate WP_049904537.1 C447_RS14190 sugar kinase
Query= reanno::Phaeo:GFF709 (330 letters) >NCBI__GCF_000336675.1:WP_049904537.1 Length = 318 Score = 97.8 bits (242), Expect = 3e-25 Identities = 85/288 (29%), Positives = 125/288 (43%), Gaps = 7/288 (2%) Query: 38 AQDMMVAMGGSSANIAAGLVKMGCRSALVTSVSDDAVGWYCLNQLDHYGVDRTHVKRITG 97 A + ++ G+ N+A GL ++G + + D G Y + GVD T V+ T Sbjct: 26 AHEFEKSLAGAETNVAIGLARLGHDVGWYSKLGTDPHGEYLEFFVRGEGVDTTTVE-FTD 84 Query: 98 EYRTSLAVYESRVEDHQSVIYRNNAADFQMTIADVEAVDY---SQYSALITAGTVFAAEP 154 E T + E R +V Y + + + D VDY ++Y L T T +E Sbjct: 85 EAPTGIMFKERREFGEPAVHYYRHGSAASLMSPDDLPVDYLTNAEYLHL-TGITPALSES 143 Query: 155 SRSATFRAFDLARAAGLPIIFDVDYRPYSWPSPEVAADVLSRAGAMSDIIVGNDEEFGFM 214 R AT A + A AG+ + FD + R W S E + + ++SDI++ EE G Sbjct: 144 CRDATLLAAERATEAGMTVSFDPNVRRKLWESDERMRETMLDLVSLSDIVLPGIEE-GAA 202 Query: 215 AGGIDKGRAKARALAETSASVVVYKMGPKGAVTFADGQEIRTGIYPVD-ALKPTGAGDSF 273 G D A A A + A V K+G GAV R Y V+ + P GAGD F Sbjct: 203 LFGTDDPEAIAAACLDHGAGTAVVKLGAAGAVVADGSTTERVSGYDVERVVDPVGAGDGF 262 Query: 274 MAGFLASLSEGRPMKDAILRGSACASVVVAKPGCAPAMPDLAALEAFL 321 AGFLAS EG+ +A +A + G +P L+ F+ Sbjct: 263 AAGFLASRIEGQGPVEATETANAVGAFATTVAGDTEGLPTRKELDVFV 310 Lambda K H 0.319 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 318 Length adjustment: 28 Effective length of query: 302 Effective length of database: 290 Effective search space: 87580 Effective search space used: 87580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory