Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate WP_007692757.1 C447_RS08145 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >NCBI__GCF_000336675.1:WP_007692757.1 Length = 397 Score = 109 bits (272), Expect = 2e-28 Identities = 92/324 (28%), Positives = 146/324 (45%), Gaps = 36/324 (11%) Query: 99 IVGALVWPFFGSRGAVDIATLILIYV-MLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYAL 157 +V V PF G + + Y M + + V G G + G+ F+AVG Y+ L Sbjct: 43 VVAFAVLPFAGISTTQLLVLIGAFYFGMFAMSWDTVSGYTGEISFGHALFFAVGGYTSTL 102 Query: 158 LSHYFGLSFWICLPIAGMMAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDI 217 L+ +G+S + +P ++AA G L+G P LR+RG YL+++TL I+ DI Sbjct: 103 LNLGYGVSPGLSIPAGVVLAAVAGVLIGVPALRVRGPYLSLITLVAPLILLQVFVIYGDI 162 Query: 218 TGGPNGISNIEKPTFFGLTFERKAAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAAL 277 GG G+S A GL + ++ + V+ Y + L LA + Sbjct: 163 FGGELGLS---------------APTGLVSAPDFELV-------VLANYYIGFGLFLAIM 200 Query: 278 FVINRLLRMPIGRAWEALREDEIACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQ-G 336 ++ + R +G A+REDE A A GLN KL AF L AA G AG+ F G Sbjct: 201 GLLFVVTRSDVGSVLTAVREDEDAVAAAGLNVAKFKLFAFVLSAAVGGLAGAVFVHTPIG 260 Query: 337 LVTPESFTFIESAI-ILAIVVLGGMGSQLGVILAAIVMILLPEMMRE-----------FS 384 P + +I +L +LGGMG+ +G L + +++ + Sbjct: 261 SPRPSQLLALTVSIEVLIAAILGGMGTIVGAGLGGVFFYFFNDVLNQQGWTLPVLGVGVD 320 Query: 385 EYRMLMFGALMVLMMIWRPQGLLP 408 E +L+F L ++++ PQG+ P Sbjct: 321 EASLLIFVLLTMVVVYALPQGVFP 344 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 397 Length adjustment: 31 Effective length of query: 387 Effective length of database: 366 Effective search space: 141642 Effective search space used: 141642 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory