Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_007691607.1 C447_RS05270 SDR family oxidoreductase
Query= metacyc::MONOMER-16230 (256 letters) >NCBI__GCF_000336675.1:WP_007691607.1 Length = 253 Score = 155 bits (391), Expect = 1e-42 Identities = 102/250 (40%), Positives = 143/250 (57%), Gaps = 11/250 (4%) Query: 6 KTVIVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGGTAIAVGA 65 KTV +TGA GIGRA A CA +GA VV+ +D R G E IA GG A Sbjct: 6 KTVFITGAGAGIGRATAERCADEGATVVV----TDVDREGGEETVERIADAGGEATFHEL 61 Query: 66 DAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLD-MPRELYLKTVGTNLNGAYFT 124 D +D D+ E V V+ G +DV+VNNAGI + ++ + + + NL G + Sbjct: 62 DVSDADAFEDCVDTVVDEHG-LDVVVNNAGIGHAPAAVEETDTRTFERVLDVNLRGVWNG 120 Query: 125 VQAAARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIALGPYGIRC 184 AA +K Q GAI+ V S+++L+G Q+ Y+ TK +L+ ++ A GP+ +R Sbjct: 121 CHAALPVLKAQ-ESGAIVNVGSLASLLGLPKQSVYSLTKGAVLNFTRAVAAEAGPHDVRA 179 Query: 185 NAVLPGTIATDINKEDLS---DLEKR-ERMTSRVPLGRLGEPDDLAGPIVFLASDMARYV 240 NAV PG T + ++ + D EK ERMT++ PL RLGEP+++AG I FLAS+ A YV Sbjct: 180 NAVCPGFTDTQLGQQYFASQGDPEKAIERMTAQYPLRRLGEPEEVAGCIAFLASEDASYV 239 Query: 241 TGASLLVDGG 250 TG L+VDGG Sbjct: 240 TGQGLVVDGG 249 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 253 Length adjustment: 24 Effective length of query: 232 Effective length of database: 229 Effective search space: 53128 Effective search space used: 53128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory