Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; L-KDR 4-dehydrogenase; EC 1.1.1.401 (characterized)
to candidate WP_007690719.1 C447_RS02885 SDR family oxidoreductase
Query= SwissProt::Q1NEI6 (249 letters) >NCBI__GCF_000336675.1:WP_007690719.1 Length = 258 Score = 140 bits (352), Expect = 3e-38 Identities = 92/247 (37%), Positives = 127/247 (51%), Gaps = 10/247 (4%) Query: 10 GRCAIVTGGASGLGKQVAARIIAEGGAVALWDLNGDALAATQAEIDATHV----VALDVS 65 G+ A+VTG GLG +A G VA+ D++ + EI V V DVS Sbjct: 11 GQRAVVTGAGRGLGNVMATAYAEAGADVAIVDVDAETAEQAADEIAELGVETTSVTADVS 70 Query: 66 DHAAVAAAAKDSAAALGKVDILICSAGITGATVPVWEFPVDSFQRVIDINLNGLFYCNRE 125 D A V A + LG +DIL+ +AGI T P E PVD +Q +D+NL G+F C++ Sbjct: 71 DEAEVEAMTETVVDRLGGIDILLNNAGIVSNT-PAEEMPVDEWQATMDVNLTGVFLCSKH 129 Query: 126 VVPFMLENGYGRIVNLASVAGKEGN-PNAS-AYSASKAGVIGFTKSLGKELAGKGVIANA 183 V MLE G G IVN++S++G N P AY+ASKAGVI T+SL E +GV N+ Sbjct: 130 VGRHMLERGSGTIVNISSMSGLVANHPQPQIAYNASKAGVIMVTRSLASEWGDRGVRVNS 189 Query: 184 LTPATFESPILDQLPQ---SQVDYMRSKIPMGRLGLVEESAAMVCFMASEECSFTTASTF 240 + P + +++ + + + R PMGRLG E + F+ASE SF Sbjct: 190 IAPGYMRTDLVEDVLEEDPEMAETWREYTPMGRLGKPTELGPVAVFLASEASSFMNGEIV 249 Query: 241 DTSGGRT 247 GG T Sbjct: 250 SFDGGYT 256 Lambda K H 0.318 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 258 Length adjustment: 24 Effective length of query: 225 Effective length of database: 234 Effective search space: 52650 Effective search space used: 52650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory