Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_007693271.1 C447_RS09450 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000336675.1:WP_007693271.1 Length = 298 Score = 233 bits (594), Expect = 4e-66 Identities = 125/255 (49%), Positives = 169/255 (66%), Gaps = 2/255 (0%) Query: 13 SPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQ 72 +P L + L K FGGL AVD ++EGS+TGLIGPNGAGK+T F+ ++ RP Sbjct: 41 TPPGKPLRVRDLRKEFGGLTAVDGVSFDIEEGSLTGLIGPNGAGKSTTFDCITGVHRPTG 100 Query: 73 GEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLIN 132 G V + I L PH+IA RG VRTFQ+ + L+ +TVLENMLLA + Q GE ++ Sbjct: 101 GSVHLRDEEITGLRPHRIANRGLVRTFQITRELTEMTVLENMLLAPRGQRGESLWRSVLP 160 Query: 133 FRR--VQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILL 190 R V+ +ER R++A LE + A++YAG LSGGQRKLLEMARAL+++P ++LL Sbjct: 161 GARGGVRTQERELRDRAWETLERFEIDHLAEEYAGNLSGGQRKLLEMARALLTDPDVVLL 220 Query: 191 DEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTP 250 DEP AGVNPTL ++ + +G TFL++EH+MDVIM C V V+ +GR LAD P Sbjct: 221 DEPLAGVNPTLERKLLAQVHELREEGYTFLLVEHDMDVIMEHCERVIVMHQGRVLADDDP 280 Query: 251 EQIQSDPRVLEAYLG 265 E +++D RV++AYLG Sbjct: 281 ETVRADERVIDAYLG 295 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 298 Length adjustment: 26 Effective length of query: 241 Effective length of database: 272 Effective search space: 65552 Effective search space used: 65552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory