Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate WP_007692562.1 C447_RS07650 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b20327 (276 letters) >NCBI__GCF_000336675.1:WP_007692562.1 Length = 290 Score = 141 bits (355), Expect = 2e-38 Identities = 84/269 (31%), Positives = 141/269 (52%), Gaps = 3/269 (1%) Query: 6 AKRTAFYALVAVIILVAVFPFYYAILTSLKSGTAL--FRIDYWPTDISLANYAGIFSHGT 63 A A Y ++ V + FP + + T+LK+G+ L F P + SL + G Sbjct: 20 ADLAARYTILLVTSALVAFPLLWMVSTALKTGSDLTAFPPTLVPENPSLEPTIEALTTGP 79 Query: 64 FVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLAGL 123 + + N+ LV V + L++AV AAYALAR F G L+ ++I++ M P ++ + Sbjct: 80 WAQWFLNTFLVVIGAVILELVVAVPAAYALARREFLGDRLVYVSIVAFLMIPPQILVLPI 139 Query: 124 FELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVVITR 183 F + + T + LI +Y + F ++L+ F + LP ++E+AA + G W + R Sbjct: 140 FIQFAQLQLLETFVGLIVAYTLLFSAFVTFLLSGFFQTLPSDVEDAARIAGIPEWKIFVR 199 Query: 184 VFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPWGNI 243 + +PL PA+ + FI AWNEF +AL F + T+ + + + G+Q +I + Sbjct: 200 IVLPLAKPAIGIAAIFVFIFAWNEFFWALVFLNEQEMYTISIGLTIFE-GTQGQIAMNRL 258 Query: 244 MAASVIVTVPLVVLVLIFQRRIISGLTAG 272 MA SV+ T+P++VL + Q R I G+T G Sbjct: 259 MAMSVLTTIPVLVLFALTQERFIQGITTG 287 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 290 Length adjustment: 26 Effective length of query: 250 Effective length of database: 264 Effective search space: 66000 Effective search space used: 66000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory