Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_007691239.1 C447_RS04210 daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000336675.1:WP_007691239.1 Length = 339 Score = 129 bits (323), Expect = 1e-34 Identities = 82/238 (34%), Positives = 127/238 (53%), Gaps = 17/238 (7%) Query: 6 LEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRLD 65 + + LT FG + AV+ ++ V E ++ +IGPNGAGK+T+ N L PT G R++ Sbjct: 4 IRIDELTKEFGSVTAVDDLSFSVAEGELFGLIGPNGAGKSTLINMLVTLLGPTSGTARVN 63 Query: 66 GEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFRR 125 G +I+ G G+V FQ L +E+T VENL F A L+ R+ Sbjct: 64 GHDIRDETGAVRDSLGIV--FQEPALDEELTGVENLA----------FHARLYGQ---RK 108 Query: 126 SEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGLN 185 +ER+A L+ V+L E +R G + G QRRLEI R ++ P +L LDEP GL+ Sbjct: 109 AERDAR--IPEVLDLVDLAEEGDRPVGEYSGGMQRRLEIGRGLLHEPAVLFLDEPTVGLD 166 Query: 186 PKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRD 243 + D I ++ E VT++L H M+ ++ D + + ++G+ +A TPE +RD Sbjct: 167 ARTRRDTWEYIRRMNEESGVTIVLTTHYMEEADALCDRVGIFDEGSLVALDTPENLRD 224 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 339 Length adjustment: 26 Effective length of query: 229 Effective length of database: 313 Effective search space: 71677 Effective search space used: 71677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory