Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_007692756.1 C447_RS08140 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000336675.1:WP_007692756.1 Length = 277 Score = 172 bits (436), Expect = 7e-48 Identities = 94/249 (37%), Positives = 152/249 (61%), Gaps = 11/249 (4%) Query: 5 ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRL 64 +L + G+T RFGGL AV+ ++ VE +++ IGPNGAGK+T F+C+TG + PT G +R Sbjct: 37 LLVLDGVTKRFGGLTAVDDLSFAVESGEILGFIGPNGAGKSTTFDCVTGVFPPTEGTVRY 96 Query: 65 DGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFR 124 DGE++ G H++ ++G+ RTFQ+ R + + ++N+ +A L+GL Sbjct: 97 DGEDVTGTATHRMVKRGLARTFQSFRPLSDRSVLDNVALALTPD-KVFTLSGL------- 148 Query: 125 RSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGL 184 + A E V L + + S L + RLE+AR + T P +L++DEP AGL Sbjct: 149 --RGRTHDRARAVCERVGLGDRLDVSPSELPHAGLLRLELARALATDPDLLLVDEPFAGL 206 Query: 185 NPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRDN 244 + E + + L+A LR E +T+++++H+M+ ++S+ D VVI GA LA+GTP++IR N Sbjct: 207 STGEVESVSDLLADLRDE-GLTLVVVDHNMRGLLSLIDRAVVIRFGAKLAEGTPDEIRSN 265 Query: 245 PDVIKAYLG 253 +V +AYLG Sbjct: 266 EEVQEAYLG 274 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 277 Length adjustment: 25 Effective length of query: 230 Effective length of database: 252 Effective search space: 57960 Effective search space used: 57960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory