Align Phosphoglucomutase/phosphomannomutase; PGM/PMM; EC 5.4.2.2; EC 5.4.2.8 (characterized)
to candidate WP_007690695.1 C447_RS02840 phosphoglucosamine mutase
Query= SwissProt::Q68BJ6 (456 letters) >NCBI__GCF_000336675.1:WP_007690695.1 Length = 440 Score = 266 bits (680), Expect = 1e-75 Identities = 160/452 (35%), Positives = 242/452 (53%), Gaps = 17/452 (3%) Query: 4 LFGTFGVRGIANEEITPEFALKIGMAFGTLLKREGRERPLVVVGRDTRVSGEMLKDALIS 63 +FGT G+RG E+T E AL +G A G R VVVGRD R SG +L DAL + Sbjct: 1 MFGTSGIRGPVGSEVTAELALALGRALGIDSDR-------VVVGRDPRESGLLLVDALTA 53 Query: 64 GLLSTGCDVIDVGIAPTPAIQWATNHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKKE 123 GL +G DV+D G+A TP + A +AD G +TASHNP NG+KL +P+G E Sbjct: 54 GLRESGTDVLDAGLAATPTVARAVGWHDADAGVSVTASHNPAPDNGLKLWQPSGQAFTGE 113 Query: 124 REAIVEELFFSEDFHRAKWNEIGELRKEDIIKPYIEAIKNRVDVEAIKKRRPFVVVDTSN 183 + + E F A W+++G+ + D + ++E ++ V ++ P VVVD N Sbjct: 114 DQDRIAGRIREEAFEPADWDDLGDRIEIDAGERHVETLREAVPID----DPPSVVVDLGN 169 Query: 184 GAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKGFMEIVKALGADFGVAQD 243 GAG +++ L LGC+V ++NA PDG FP R EP EN + +V+ AD G+A D Sbjct: 170 GAGGVSVA-ALTALGCEVETLNAQPDGAFPGRPSEPTAENCESLRALVETTDADLGIAHD 228 Query: 244 GDADRAVFIDENGRFIQGDKTFALVADAVLREN--GGGLLVTTIATSNLLDDIAKRNGAK 301 GDADR + G ++ GD AL A +RE+ + + TS + D GA Sbjct: 229 GDADRLRGVTGEGEYLSGDVLLALFACEAVRESEVENPEVAAPVDTSLAVADALAPLGAT 288 Query: 302 VMRTKVGDLIVARALLENNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVEIFAKSGKKFS 361 V T+VGD VA + + GGE +G I+P+ L DG + ++ E+ A+ + + Sbjct: 289 VTYTRVGDGFVAERATDPDVVFGGEPSGAWIWPNQTLCPDGPLAACRLAELAAE--RPLA 346 Query: 362 ELIDELPKYYQFKTKRHVEGDRKAIVAKVAELAEKKGYKIDTTDGTKIIFDDGWVLVRAS 421 + + E+ Y + V D+ ++ +VAE + ++ T DG + D+GW L+RAS Sbjct: 347 DRVAEIETYPIARESVEV-ADKSGVMDRVAERVNEAFEEVRTLDGVRADLDEGWFLIRAS 405 Query: 422 GTEPIIRIFSEAKSEEKAREYLELGIKLLEEA 453 GT+P++RI +EA+S+E E +E+A Sbjct: 406 GTQPLVRITAEARSQEACTSAFETASGFVEDA 437 Lambda K H 0.317 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 440 Length adjustment: 33 Effective length of query: 423 Effective length of database: 407 Effective search space: 172161 Effective search space used: 172161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory