Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_007695653.1 C447_RS15655 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000336675.1:WP_007695653.1 Length = 332 Score = 113 bits (282), Expect = 5e-30 Identities = 73/234 (31%), Positives = 129/234 (55%), Gaps = 10/234 (4%) Query: 1 MLSFDKVSTYYGK-IQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIR 59 M+ FD V Y +A+ EV++G L+G +G GK+T + + + G+I Sbjct: 1 MIRFDNVHKQYPDGTRAVDGHDFEVEEGTTTVLVGPSGCGKTTTMRLVNRLEEPTEGTIY 60 Query: 60 YEGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLA----MGGFFTDKDDYQVQMDK 115 Y+G ++ L +T +R+ I V + +F +TV EN+A + G+ ++ +V D+ Sbjct: 61 YDGTDIEEL-EATDLRREIGYVIQDIGLFDHMTVGENVATVPELKGWEAERTADRV--DE 117 Query: 116 VLELFPRLKERY-EQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFE 174 +LEL E + + G +SGG+QQ + + RAL + P ++L+DEP L PI +++ + Sbjct: 118 LLELMGLPPEEFRDSYPGELSGGQQQRVGVARALAAGPDVMLMDEPFGALDPITREELQD 177 Query: 175 IIEQLRRE-GVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVR 227 +++E T+ V + N+ALK+ D+ V+ G++V +DT ALL NPK + Sbjct: 178 EFLDIQKEIDTTIVFVTHDINEALKMGDKIAVMNEGKVVQYDTPTALLDNPKTK 231 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 332 Length adjustment: 25 Effective length of query: 208 Effective length of database: 307 Effective search space: 63856 Effective search space used: 63856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory