Align High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized)
to candidate WP_007693270.1 C447_RS09445 branched-chain amino acid ABC transporter permease
Query= SwissProt::P22729 (425 letters) >NCBI__GCF_000336675.1:WP_007693270.1 Length = 445 Score = 144 bits (363), Expect = 5e-39 Identities = 105/336 (31%), Positives = 158/336 (47%), Gaps = 35/336 (10%) Query: 69 LKSVSGPKFILPAIDGSTVKQKLFLVALLVLAVAWPFMVSRGTV-----DIATLTMIYII 123 + +V G + L D + V +F + L + W +S G + + L +Y + Sbjct: 1 MSAVEGLRRRLSGTDTTLVLGVVFGLYALYIVFGWMLGLSVGGIVSTLQQVTFLAAVYAL 60 Query: 124 LGLGLNVVVGLSGLLVLGYGGFYAIGAYTFALLNHYY----------GLGFWTCLPIAGL 173 + L LN+ G +GL +G GF A+GAYT A+L GL W + L Sbjct: 61 VALALNLQWGYAGLFNIGVAGFMAVGAYTMAMLTAPVNPEVGGIPGLGLPLWVGIVGGML 120 Query: 174 MAAAAGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEI-----------TGGPNGI 222 AA G + P LRLR DYLAIVTL EI+R L+ N+T + TGG GI Sbjct: 121 AAALVGAVAALPALRLRADYLAIVTLALSEIIR-LIYNSTPVQTFSLGGVELGTGGARGI 179 Query: 223 SQIPKPTLFGLEFSRTAREGGWDT------FSNFFGLKYDPSDRVIFLYLVALLLVVLSL 276 Q P + L ++ A G T F F GL + V Y + L+L V++ Sbjct: 180 -QAPTNPVGALYYTDPASPGAGTTALGDAVFGFFSGLGIGDTTVVDSTYTLVLVLFVVAF 238 Query: 277 FVI-NRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISAAFAGFAGTLFAARQG 335 +++ +R+ P GR +A+REDE+ +LG + RR K+ F + A G AG L+ QG Sbjct: 239 YLLLSRVGNSPFGRVLKAIREDELVANALGKNTRRFKVKTFMLGCALMGLAGILWQGSQG 298 Query: 336 FVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAIL 371 ++P F + +V V++GG GS ++ L Sbjct: 299 RITPAQFLPIVTFYVFTAVIIGGSGSNTGSVIGGAL 334 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 445 Length adjustment: 32 Effective length of query: 393 Effective length of database: 413 Effective search space: 162309 Effective search space used: 162309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory