Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_007693924.1 C447_RS11155 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000336675.1:WP_007693924.1 Length = 368 Score = 295 bits (754), Expect = 2e-84 Identities = 167/360 (46%), Positives = 227/360 (63%), Gaps = 28/360 (7%) Query: 1 MAGIKIDKINKFYGTTQ----ALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVS 56 M I+I+++ K Y T A+ D++L IEDGEF+VFVGPSGCGKST LR +AGLE V+ Sbjct: 1 MTQIEINELTKEYDTGDSAIVAVEDLDLSIEDGEFIVFVGPSGCGKSTTLRCIAGLESVT 60 Query: 57 SGRIEIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNG-FEPDLRKERIA 115 G I V + P DRD+AMVFQ+YALYPHMTV++NM FG+K++ R+ Sbjct: 61 DGEIRFDDEVVNDLRPRDRDVAMVFQNYALYPHMTVKQNMSFGLKLSSQLSSGEIDSRVT 120 Query: 116 EAARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVE 175 +AA ++ ++D L ++PG+LSGGQ+QRVA+GR+IV+ P VFL DEPLSNLDAKLR MR E Sbjct: 121 DAAEMMGIDDLLGKRPGELSGGQQQRVALGRSIVREPGVFLMDEPLSNLDAKLRAGMRTE 180 Query: 176 LEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIG 235 ++ L +L T IYVTHDQ EAM M D+I VLN G ++Q P +LY P + FVA+FIG Sbjct: 181 IQELQNELDVTTIYVTHDQTEAMAMGDRIAVLNGGVLQQAAVPEELYRNPVNEFVADFIG 240 Query: 236 SPAMNVFSSDVGLQDISL----------------DASAAFVGCRPEHIEIVPDGDGHIAA 279 SP++N+F DV ++ L + S A +G RPE + I GD Sbjct: 241 SPSINLF--DVTVEGTRLAGPGGFTYRLSGFDLGERSHARMGVRPEDLAIDERGDD---L 295 Query: 280 TVHVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFD-EAGRAI 338 TV V E++G E+ +Y G GG ++VAR + V L F ++ F+ ++GRAI Sbjct: 296 TVTVVEKMGNENFIY-GELGGQEVVARTDSSIRPEPDDEVGLAFEEEAVYFFEPDSGRAI 354 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 368 Length adjustment: 29 Effective length of query: 309 Effective length of database: 339 Effective search space: 104751 Effective search space used: 104751 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory