Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_007692562.1 C447_RS07650 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_000336675.1:WP_007692562.1 Length = 290 Score = 153 bits (387), Expect = 4e-42 Identities = 86/266 (32%), Positives = 146/266 (54%), Gaps = 3/266 (1%) Query: 7 LFSQIALLVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFE-PTLSNYREALFEDGVL 65 L ++ +L++ + FP WMV+T+LKT PP + E P+L EAL Sbjct: 22 LAARYTILLVTSALVAFPLLWMVSTALKTGSDLTAFPPTLVPENPSLEPTIEALTTGPWA 81 Query: 66 RTLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFL 125 + +N+ ++ I L LV+ VPAA+ALAR EF G + ++ + MI P +L LP F+ Sbjct: 82 QWFLNTFLVVIGAVILELVVAVPAAYALARREFLGDRLVYVSIVAFLMIPPQILVLPIFI 141 Query: 126 IARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKIC 185 L LL+ + LI+ Y V ++++ F+ +P D+++AAR+ G ++ I +I Sbjct: 142 QFAQLQLLETFVGLIVAYTLLFSAFVTFLLSGFFQTLPSDVEDAARIAGIPEWKIFVRIV 201 Query: 186 LPLAMPGVAVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFMEGY--NLPYGKIMAT 243 LPLA P + ++AIF FIF+WNE + L+ + ++ ++ EG + ++MA Sbjct: 202 LPLAKPAIGIAAIFVFIFAWNEFFWALVFLNEQEMYTISIGLTIFEGTQGQIAMNRLMAM 261 Query: 244 STLIVIPVLIFALIASKQLVRGLTMG 269 S L IPVL+ + ++ ++G+T G Sbjct: 262 SVLTTIPVLVLFALTQERFIQGITTG 287 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 290 Length adjustment: 26 Effective length of query: 246 Effective length of database: 264 Effective search space: 64944 Effective search space used: 64944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory