Align FAA hydrolase family protein (characterized, see rationale)
to candidate WP_007690519.1 C447_RS02350 fumarylacetoacetate hydrolase family protein
Query= uniprot:A0A2E7P912 (281 letters) >NCBI__GCF_000336675.1:WP_007690519.1 Length = 242 Score = 134 bits (337), Expect = 2e-36 Identities = 75/202 (37%), Positives = 116/202 (57%), Gaps = 13/202 (6%) Query: 72 KFICIGLNYADHAAESNLPIPAEPVVFNKWTSAVVGPNDDVKIPRGSKKTDWEVELGVVI 131 K +CIGLNYADHA E + +P P++F K +AV G D V +P G +K + E EL VVI Sbjct: 45 KIVCIGLNYADHAEEEGMDLPDRPLLFLKPPNAVSGHGDTVTLPEGKEKVEHEAELAVVI 104 Query: 132 GKGGSYIDEKDAMSHVAGYCVVNDVSEREYQ-IERGGTWDKGKGCDTFGPIGPWLVTRDE 190 G+ + DAM VAG+ +DVS R+ Q +E+ W +GK D P+GP L ++ Sbjct: 105 GEQCRNVAADDAMDVVAGFTCADDVSNRDDQRVEQ--NWVRGKAFDNACPLGPVLADPED 162 Query: 191 VADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPGDVISTGTPPGVGMG 250 V P + L ++G+ Q+ + + +F V ++ ++++M+L+ GDVI TGTP GVG Sbjct: 163 V--PDDASVELRLNGETVQSSSRAEFVFSVPELIEEITQYMTLEAGDVIITGTPAGVG-- 218 Query: 251 VKPEAVYLRAGQTMRLGIDGLG 272 L G + + ++G+G Sbjct: 219 ------ELEDGDEVEVEVEGVG 234 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 242 Length adjustment: 25 Effective length of query: 256 Effective length of database: 217 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory