Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_017540510.1 C892_RS0115135 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000341205.1:WP_017540510.1 Length = 268 Score = 201 bits (510), Expect = 2e-56 Identities = 107/241 (44%), Positives = 155/241 (64%), Gaps = 11/241 (4%) Query: 6 NKVLLQVKGLKVAY-GGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDG 64 ++ LL +K Y + + G +REGE+V +IG NGAGK+T +K + G L + G Sbjct: 28 SEFLLVADEVKAGYIPEVNILDGCTLTLREGEVVGVIGPNGAGKSTLIKTVFGLLPVRGG 87 Query: 65 NIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIR----KDKAGILA 120 + G SI A +LV+ G+ VP+ + VF +T+ ENL+MG ++R +++ ++A Sbjct: 88 ELVLRGSSIANLSAHELVERGVGYVPQTQNVFPSLTVEENLEMGVFLRPKAFRERFAVVA 147 Query: 121 DIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDK 180 ++ FP L ER+ Q AG +SGGE+QM+AMGRALM +P V+LLDEP+ GLSPI D+ Sbjct: 148 EL------FPLLAERRRQKAGALSGGERQMVAMGRALMMEPSVVLLDEPTAGLSPIYQDE 201 Query: 181 IFEVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAAYL 240 +FE VR + A GV++++VEQNA R L I DRGYV++ G TG G++LL DP V YL Sbjct: 202 VFERVRQINAAGVSVIMVEQNARRCLQICDRGYVLDQGRNAYTGTGRELLEDPNVIELYL 261 Query: 241 G 241 G Sbjct: 262 G 262 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 268 Length adjustment: 24 Effective length of query: 218 Effective length of database: 244 Effective search space: 53192 Effective search space used: 53192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory