Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_017556214.1 C892_RS0104280 urea ABC transporter permease subunit UrtB
Query= TCDB::Q8YXD0 (288 letters) >NCBI__GCF_000341205.1:WP_017556214.1 Length = 294 Score = 127 bits (318), Expect = 4e-34 Identities = 88/290 (30%), Positives = 151/290 (52%), Gaps = 10/290 (3%) Query: 1 MDIQTIQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFVNTF--- 57 MD QL + AVG+++ LAA+GL T+G + + N AHG+FL +GAY F + + Sbjct: 1 MDALLAQLPI-AAAVGAVLLLAALGLNFTFGQMGVINMAHGEFLMVGAYTAFALQAWAGL 59 Query: 58 -GVNIWLSMIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIW 116 G + L++ A T + L E+ L +R ++++ G++L L+ ++ Sbjct: 60 GGGAVLLALPAAFALTALMGLALERGL---IRHFYGRPLDTLLLTFGVSLVLQQLARDVF 116 Query: 117 GGRNQNYNLP--ITPALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVAD 174 G N + P + + GV + ++L ++ALA L++ A+ + ++ G+ MRAV Sbjct: 117 GAPNVDVTAPAWLAGGTRVLGVWLHHSRLFIIALAALAVVAIALYIGRSRSGRYMRAVLH 176 Query: 175 DLDLAKVSGIDVEQVIFWTWLIAGTVTSLGGSMYGLITAVRPNMGWFLILPLFASVILGG 234 D DLA VSGI V +V T+ + + + G LI + P++G I+ F V++GG Sbjct: 177 DRDLAAVSGIPVGRVDAATFAVGSGLAGVAGVALALIGPIGPSIGTSYIVDAFLVVVVGG 236 Query: 235 IGNPYGAIAAAFIIGIVQEVSTPFLGSQYKQGVALLIMILVLLIRPKGLF 284 +G+ GA+ AAF +G + S + + + V +I L RP+GLF Sbjct: 237 LGSLRGAVVAAFGLGALNAYSELWTDASLAKVVVFAAIIAFLQARPQGLF 286 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 294 Length adjustment: 26 Effective length of query: 262 Effective length of database: 268 Effective search space: 70216 Effective search space used: 70216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory