Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.109) (characterized)
to candidate WP_017537197.1 C892_RS0126835 electron transfer flavoprotein subunit beta/FixA family protein
Query= BRENDA::Q18AQ6 (260 letters) >NCBI__GCF_000341205.1:WP_017537197.1 Length = 254 Score = 145 bits (366), Expect = 8e-40 Identities = 82/242 (33%), Positives = 138/242 (57%), Gaps = 2/242 (0%) Query: 7 IKQVPDT-TEVKLDPNTGTLIRDGVPSIINPDDKAGLEEAIKLKEEMGAHVTVITMGPPQ 65 +KQVPDT TE KL + TL R +IN D+ +EEA+ L+E+ G VTV+TMGP Q Sbjct: 2 VKQVPDTATERKLSSDDFTLDRAASDGVINELDEYAIEEALLLREKHGGEVTVLTMGPDQ 61 Query: 66 ADMALKEALAMGADRGILLTDRAFAGADTWATSSALAGALKNIDFDIIIAGRQAIDGDTA 125 A ++++AL+MGAD+ + L D A G+D T+ AL+ AL I+FD+++ G ++ D T Sbjct: 62 ATDSIRKALSMGADKAVHLVDDALHGSDALQTAYALSKALGTIEFDLVVLGSESTDARTG 121 Query: 126 QVGPQIAEHLNLPSITYAEEIKTEGEYVLVKRQFEDCCHDLKVKMPCLITTLKDMNTPRY 185 VG +AE+L LP +T A ++ +G V V+RQ + ++ ++P +++ ++ +N PRY Sbjct: 122 VVGAALAEYLGLPQLTLAGKVDVDGSAVTVQRQTDYGYDVVEAQLPAVVSVVEKINEPRY 181 Query: 186 MKVGRIYDAFENDVVETWTVKDIEVDPSNLGLKGSPTSVFKSFTKSVKPAGTIYNEDAKT 245 I A + V + + D ++ +G + T ++ + AGT+ ++ Sbjct: 182 PSFKLIMQAKKKPVAKL-GIADAGIEAERVGTAAAGTETVEASPAPPRAAGTVVKDEGDG 240 Query: 246 SA 247 A Sbjct: 241 GA 242 Lambda K H 0.316 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 254 Length adjustment: 24 Effective length of query: 236 Effective length of database: 230 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory