Align NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_017557904.1 C892_RS0115125 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YY08 (377 letters) >NCBI__GCF_000341205.1:WP_017557904.1 Length = 328 Score = 132 bits (332), Expect = 1e-35 Identities = 69/167 (41%), Positives = 108/167 (64%), Gaps = 6/167 (3%) Query: 213 LMLVSLLVLAFVFWRLEYLVRSPWGRVLKAIREDEEIPKAMGKNVFWYKLQSLMLGGAIA 272 LM+V+ ++A L+ SPWGRV+K IREDE+ +++GK+VF YK QSL+LGG + Sbjct: 157 LMVVTWGLVALALALTASLMHSPWGRVIKGIREDEDAVRSLGKDVFVYKTQSLVLGGVLG 216 Query: 273 GIAGAFFAWQISAIYPDNFQPQLTFDSWIMVILGGAGNNIGSILGAVIYF----AYDAIT 328 G+ GA A I PD F PQ+TF W M++LGGA G++LG ++ + A+D Sbjct: 217 GLGGAMLAINQQNITPDQFMPQVTFYLWAMLLLGGAARTFGAVLGPMVLWFLLTAFDETL 276 Query: 329 RE-VLPKIIP-LDEARLGAFRIMCIGLILMVLMIWRPQGILGKKEEL 373 R V ++P +D + +GA R +GL L++L+++RPQG++G ++E+ Sbjct: 277 RALVSADLLPFVDGSDIGALRHAFVGLALVLLIVYRPQGLIGDRKEM 323 Lambda K H 0.328 0.145 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 328 Length adjustment: 29 Effective length of query: 348 Effective length of database: 299 Effective search space: 104052 Effective search space used: 104052 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory