Align L-serine dehydratase, alpha chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate WP_017555996.1 C892_RS0103010 L-serine ammonia-lyase
Query= uniprot:P33073 (292 letters) >NCBI__GCF_000341205.1:WP_017555996.1 Length = 456 Score = 134 bits (337), Expect = 4e-36 Identities = 94/278 (33%), Positives = 141/278 (50%), Gaps = 9/278 (3%) Query: 4 TAREIIDVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSDVT 63 T E++ G+ + ++L E T +E+R+ L + VM + ++ S V Sbjct: 176 TGEELLAHTRRTGLPVSGVMLANE--RVRRTGDEVREGLLHIWSVMGECVDRGMSTSGVL 233 Query: 64 ----EYKMIDGFAKRTYEYANSGKSIVGDFLAKAMAMAFSTSEVNASMGKIVAAPTAGSS 119 + G + E A G L A + +E NA+ G++V APT G++ Sbjct: 234 PGGLRVRRRAGGLRARLE-AGGGDDDALAALEWVTLFALAVNEENAAGGRVVTAPTNGAA 292 Query: 120 GIMPAMLVAATEKY-NFDRTTIQNGFLTSIGIGQVITKYATFAGAEGGCQAECGSASAMA 178 GI+PA+L A + +F + LT+ IG + + A+ +GAE GCQ E GSA +MA Sbjct: 293 GIVPAVLHYARDFLPSFGSEAVVRFLLTAGAIGILFKENASISGAEVGCQGEVGSACSMA 352 Query: 179 AAALVEMLGGTVEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFISADLA 238 AA L E++GGT EQ +AA I + + LGL CDP+ GLVQ PC RNA + A +A +A Sbjct: 353 AAGLAEVIGGTPEQVENAAEIGLEHNLGLTCDPVGGLVQIPCIERNAVAAVKAITAARMA 412 Query: 239 LAG-VESLVPFDEVVIAMGEVGNSMIEALRETGLGGLA 275 + G V D + M + G M + +ET GGLA Sbjct: 413 VRGDGRHHVSLDNAITTMRQTGADMKDKYKETARGGLA 450 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 456 Length adjustment: 29 Effective length of query: 263 Effective length of database: 427 Effective search space: 112301 Effective search space used: 112301 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory