Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_018371978.1 BN415_RS05890 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_000341525.1:WP_018371978.1 Length = 246 Score = 226 bits (575), Expect = 4e-64 Identities = 123/242 (50%), Positives = 165/242 (68%), Gaps = 1/242 (0%) Query: 14 IIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQGRIVV 73 I++++ + K +G+ VLKDI+L + +GE I + G SGSGKST +R +N LE+ G I Sbjct: 5 ILEIKHLKKSFGKNEVLKDISLTIHEGEVISIIGSSGSGKSTLLRSINLLEQPSGGEIHY 64 Query: 74 DGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEEIAMHY 133 G + + + R ++GMVFQ FNLF +L +L+N +A V K + +AE+IA Sbjct: 65 KGTNVLAEGYDLTHYREKLGMVFQSFNLFENLNVLENTIVAQTTVLKRDRSEAEKIAKEN 124 Query: 134 LERVRIPEQAHKY-PGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEVLDTM 192 LE+V + E+ + P QLSGGQ+QRVAIARAL M P +LFDEPTSALDPEMV EVL M Sbjct: 125 LEKVGMGERFWQAKPKQLSGGQKQRVAIARALSMNPDAILFDEPTSALDPEMVGEVLKIM 184 Query: 193 IGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPNDFFDNPQNDRTKLFLSQI 252 LA++G+TM+ VTHEM FAR V++RVIFMDKG I E+ P D F NP+ +RTK FL + Sbjct: 185 QDLAKEGLTMIVVTHEMEFARDVSDRVIFMDKGVIAEEGNPKDIFTNPKEERTKEFLQRF 244 Query: 253 LH 254 LH Sbjct: 245 LH 246 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 246 Length adjustment: 24 Effective length of query: 230 Effective length of database: 222 Effective search space: 51060 Effective search space used: 51060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory