Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_018371595.1 BN415_RS07285 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000341525.1:WP_018371595.1 Length = 289 Score = 235 bits (599), Expect = 1e-66 Identities = 128/297 (43%), Positives = 185/297 (62%), Gaps = 10/297 (3%) Query: 5 VQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAGL 64 +QQL+NGL LGS+Y L+A+GYTMVYGII +INFAHGDI+M+G F + ++ S+ Sbjct: 2 LQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFMG---YYLIGSLHMNF 58 Query: 65 PVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQVTQG 124 +A L+V+M+ T+ IE +AYRPLR S R+A LITAIG+S L + Sbjct: 59 YLA------LIVSMVGTAALGVLIEFLAYRPLRHSTRIAALITAIGVSFFLEYSMVAVVS 112 Query: 125 PRNKPIPPMVSSV-YQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRATEQDR 183 K P ++ SV + G +SV+ Q+ I+ + +L+ + IV +T +G+A RA D Sbjct: 113 ANVKAFPQVLPSVRFVLGPVSVTSIQLTILAVALILMVLLQLIVQKTKMGKAMRAVSVDS 172 Query: 184 KMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAAVLGGI 243 A L+G+NV+QTIS TF +G+ALA AG + +YY G TPG+K+F AAV+GGI Sbjct: 173 DAAQLMGINVNQTISFTFALGSALAGAAGVLIALYYNSLDPLMGMTPGLKSFVAAVIGGI 232 Query: 244 GSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGRPEVEKV 300 G +PGA GG +IG++E+ + Y+D + IL +L+ +P GILG+ EKV Sbjct: 233 GIIPGAALGGFVIGILETFATVINLSEYRDAIVYGILILILLIRPAGILGKNVKEKV 289 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 289 Length adjustment: 26 Effective length of query: 274 Effective length of database: 263 Effective search space: 72062 Effective search space used: 72062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory